PDB entry 7k84

View 7k84 on RCSB PDB site
Description: Crystal structure of BoNT/E LC-HN domain in complex with VHH JLE-E5
Class: antitoxin
Keywords: Botulinum neurotoxin (BoNT), VHH, receptor-binding domain, TOXIN, ANTITOXIN
Deposited on 2020-09-25, released 2020-10-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-10-14, with a file datestamp of 2020-10-09.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: botulinum neurotoxin type E
    Species: Clostridium botulinum [TaxId:1491]
    Gene: bont, FDB75_10755
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: jle-e5
    Species: Vicugna pacos [TaxId:30538]
    Database cross-references and differences (RAF-indexed):
    • PDB 7K84 (Start-127)
    Domains in SCOPe 2.08: d7k84b_
  • Heterogens: ZN, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >7k84B (B:)
gplgsqvqlvetggglvqaggslrlscaasgrsyamgwfrqgpgkerefvatiswsstnt
wyadsvkgrftisrdnakntvylqmnslkpedtavyycaashrfsdypmrsedgmdywgk
gtlvtvss

    Sequence, based on observed residues (ATOM records): (download) 
    >7k84B (B:)
vqlvetggglvqaggslrlscaasgrsyamgwfrqgpgkerefvatiswsstntwyadsv
kgrftisrdnakntvylqmnslkpedtavyycaashrfsdypmrsedgmdywgkgtlvtv
ss