PDB entry 7k6s

View 7k6s on RCSB PDB site
Description: Crystal structure of the bromodomain (BD) of human Bromodomain and PHD finger-containing Transcription Factor (BPTF) bound to Compound 4 (SKT1174)
Class: gene regulation
Keywords: BRD, PHD, GENE REGULATION, FAC1, FALZ, nucleosome-remodeling factor subunit
Deposited on 2020-09-21, released 2020-12-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-12-09, with a file datestamp of 2020-12-04.
Experiment type: XRAY
Resolution: 1.23 Å
R-factor: N/A
AEROSPACI score: 0.74 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nucleosome-remodeling factor subunit BPTF
    Species: Homo sapiens [TaxId:9606]
    Gene: BPTF, FAC1, FALZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d7k6sa_
  • Heterogens: VYM, EDO, GOL, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >7k6sA (A:)
smstedamtvltpltekdyeglkrvlrslqahkmawpflepvdpndapdyygvikepmdl
atmeervqrryyekltefvadmtkifdncryynpsdspfyqcaevlesffvqklkgfkas
rsh

    Sequence, based on observed residues (ATOM records): (download) 
    >7k6sA (A:)
edamtvltpltekdyeglkrvlrslqahkmawpflepvdpndapdyygvikepmdlatme
ervqrryyekltefvadmtkifdncryynpsdspfyqcaevlesffvqklkgfkasr