PDB entry 7k3l

View 7k3l on RCSB PDB site
Description: Crystal structure of dLC8 in complex with Panoramix TQ peptide
Class: motor protein
Keywords: Piwi, transposon siliencing, heterochromatin formation, piRNA pathway, transcriptional silencing, MOTOR PROTEIN
Deposited on 2020-09-11, released 2021-03-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2021-03-10, with a file datestamp of 2021-03-05.
Experiment type: XRAY
Resolution: 1.79 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Dynein light chain 1, cytoplasmic
  Species: Drosophila melanogaster [TaxId:7227]
  Gene: CTP, CDLC1, DDLC1, CG6998
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q24117 (Start-88)
  Domains in SCOPe 2.07: d7k3la_
• Chain 'B':
  Compound: Protein panoramix
  Species: Drosophila melanogaster [TaxId:7227]
  Gene: Panx, CG9754
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9W2H9 (1-End)
• Heterogens: EDO, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >7k3lA (A:)
  msdrkaviknadmseemqqdavdcatqalekyniekdiaayikkefdkkynptwhcivgr
  nfgsyvthetrhfiyfylgqvaillfksg
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >7k3lA (A:)
  rkaviknadmseemqqdavdcatqalekyniekdiaayikkefdkkynptwhcivgrnfg
  syvthetrhfiyfylgqvaillfksg
  

  
  
• Chain 'B':
  No sequence available.