PDB entry 7k3l
View 7k3l on RCSB PDB site
Description: Crystal structure of dLC8 in complex with Panoramix TQ peptide
Class: motor protein
Keywords: Piwi, transposon siliencing, heterochromatin formation, piRNA pathway, transcriptional silencing, MOTOR PROTEIN
Deposited on
2020-09-11, released
2021-03-03
The last revision prior to the SCOPe 2.08 freeze date was dated
2021-03-10, with a file datestamp of
2021-03-05.
Experiment type: XRAY
Resolution: 1.79 Å
R-factor: N/A
AEROSPACI score: 0.46
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Dynein light chain 1, cytoplasmic
Species: Drosophila melanogaster [TaxId:7227]
Gene: CTP, CDLC1, DDLC1, CG6998
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d7k3la_ - Chain 'B':
Compound: Protein panoramix
Species: Drosophila melanogaster [TaxId:7227]
Gene: Panx, CG9754
Database cross-references and differences (RAF-indexed):
- Heterogens: EDO, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>7k3lA (A:)
msdrkaviknadmseemqqdavdcatqalekyniekdiaayikkefdkkynptwhcivgr
nfgsyvthetrhfiyfylgqvaillfksg
Sequence, based on observed residues (ATOM records): (download)
>7k3lA (A:)
rkaviknadmseemqqdavdcatqalekyniekdiaayikkefdkkynptwhcivgrnfg
syvthetrhfiyfylgqvaillfksg
- Chain 'B':
No sequence available.