PDB entry 7k3k

View 7k3k on RCSB PDB site
Description: Crystal structure of dLC8 in complex with Panoramix TQT peptide
Class: motor protein
Keywords: Piwi, transposon silencing, heterochromatin formation, piRNA pathway, transcriptional silencing, RNA BINDING PROTEIN, MOTOR PROTEIN
Deposited on 2020-09-11, released 2021-03-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2021-03-10, with a file datestamp of 2021-03-05.
Experiment type: XRAY
Resolution: 1.42 Å
R-factor: N/A
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dynein light chain 1, cytoplasmic
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: CTP, CDLC1, DDLC1, CG6998
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d7k3ka_
  • Chain 'B':
    Compound: Protein panoramix
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: Panx, CG9754
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9W2H9 (1-13)
      • expression tag (0)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >7k3kA (A:)
msdrkaviknadmseemqqdavdcatqalekyniekdiaayikkefdkkynptwhcivgr
nfgsyvthetrhfiyfylgqvaillfksg

    Sequence, based on observed residues (ATOM records): (download) 
    >7k3kA (A:)
sdrkaviknadmseemqqdavdcatqalekyniekdiaayikkefdkkynptwhcivgrn
fgsyvthetrhfiyfylgqvaillfksg

  • Chain 'B':
    No sequence available.