PDB entry 7k3i

View 7k3i on RCSB PDB site
Description: Cellular retinol-binding protein 2 (CRBP2) in complex with 2-lauroylglycerol
Class: lipid binding protein
Keywords: lauroylglycerol, monoacylglycerol, retinol-binding protein, lipid binding, LIPID BINDING PROTEIN
Deposited on 2020-09-11, released 2021-03-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-04-07, with a file datestamp of 2021-04-02.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: N/A
AEROSPACI score: 0.73 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Retinol-binding protein 2
  Species: Homo sapiens [TaxId:9606]
  Gene: RBP2, CRBP2
  Database cross-references and differences (RAF-indexed):
  • Uniprot P50120 (0-133)
    • expression tag (134-137)
  Domains in SCOPe 2.08: d7k3ia1, d7k3ia2
• Heterogens: VLZ, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >7k3iA (A:)
  mtrdqngtwemesnenfegymkaldidfatrkiavrltqtkvidqdgdnfktkttstfrn
  ydvdftvgvefdeytksldnrhvkalvtwegdvlvcvqkgekenrgwkqwiegdklylel
  tcgdqvcrqvfkkklvpr