PDB entry 7k2y

View 7k2y on RCSB PDB site
Description: Crystal structure of CTX-M-14 E166A/K234R Beta-lactamase in complex with hydrolyzed ampicillin
Class: hydrolase
Keywords: antibiotic resistance, acyl-enzyme intermediate, HYDROLASE
Deposited on 2020-09-09, released 2020-11-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-06-30, with a file datestamp of 2021-06-25.
Experiment type: XRAY
Resolution: 1.62 Å
R-factor: N/A
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-lactamase
    Species: Escherichia coli [TaxId:562]
    Gene: blaCTX-M
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A2H4FY00 (0-260)
      • engineered mutation (139)
      • conflict (212)
    Domains in SCOPe 2.08: d7k2ya_
  • Heterogens: AIX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >7k2yA (A:)
tsavqqklaalekssggrlgvalidtadntqvlyrgderfpmcstskvmaaaavlkqset
qkqllnqpveikpadlvnynpiaekhvngtmtlaelsaaalqysdntamnkliaqlggpg
gvtafaraigdetfrldrtaptlntaipgdprdtttpramaqtlrqltlghalgetqraq
lvtwlkgnttgaasiraglptswtvgdrtgsgdygttndiaviwpqgraplvlvtyftqp
qqnaesrrdvlasaariiaeg