PDB entry 7jxs

View 7jxs on RCSB PDB site
Description: Crystal Structure Human Immunodeficiency Virus-1 Matrix protein Mutant Q63R Crystal Form 2
Class: structural protein
Keywords: HIV-1, gag, STRUCTURAL PROTEIN
Deposited on 2020-08-27, released 2021-04-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2021-04-14, with a file datestamp of 2021-04-09.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: matrix protein
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6E183
      • engineered mutation (61)
    Domains in SCOPe 2.07: d7jxsa_
  • Chain 'B':
    Compound: matrix protein
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6E183
      • engineered mutation (61)
    Domains in SCOPe 2.07: d7jxsb_
  • Chain 'C':
    Compound: matrix protein
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6E183
      • engineered mutation (61)
    Domains in SCOPe 2.07: d7jxsc_
  • Chain 'D':
    Compound: matrix protein
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6E183
      • engineered mutation (61)
    Domains in SCOPe 2.07: d7jxsd_
  • Chain 'E':
    Compound: matrix protein
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6E183
      • engineered mutation (61)
    Domains in SCOPe 2.07: d7jxse_
  • Chain 'F':
    Compound: matrix protein
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6E183
      • engineered mutation (61)
    Domains in SCOPe 2.07: d7jxsf_
  • Heterogens: 12P, SO4, ACT, P6G, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >7jxsA (A:)
    garasvlsggeldkwekirlrpggkkqyklkhivwasrelerfavnpglletsegcrqil
    grlqpslqtgseelrslyntiavlycvhqridvkdtkealdkieeeqnkskkkaqqaaad
    tgnnsqvsqnyhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >7jxsA (A:)
    vlsggeldkwekirlrpggkkqyklkhivwasrelerfavnpglletsegcrqilgrlqp
    slqtgseelrslyntiavlycvhqridvkdtkealdkieeeqnk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >7jxsB (B:)
    garasvlsggeldkwekirlrpggkkqyklkhivwasrelerfavnpglletsegcrqil
    grlqpslqtgseelrslyntiavlycvhqridvkdtkealdkieeeqnkskkkaqqaaad
    tgnnsqvsqnyhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >7jxsB (B:)
    vlsggeldkwekirlrpggkkqyklkhivwasrelerfavnpglletsegcrqilgrlqp
    slqtgseelrslyntiavlycvhqridvkdtkealdkieeeqnksk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >7jxsC (C:)
    garasvlsggeldkwekirlrpggkkqyklkhivwasrelerfavnpglletsegcrqil
    grlqpslqtgseelrslyntiavlycvhqridvkdtkealdkieeeqnkskkkaqqaaad
    tgnnsqvsqnyhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >7jxsC (C:)
    vlsggeldkwekirlrpggkkqyklkhivwasrelerfavnpglletsegcrqilgrlqp
    slqtgseelrslyntiavlycvhqridvkdtkealdkieeeqnkskkkaq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >7jxsD (D:)
    garasvlsggeldkwekirlrpggkkqyklkhivwasrelerfavnpglletsegcrqil
    grlqpslqtgseelrslyntiavlycvhqridvkdtkealdkieeeqnkskkkaqqaaad
    tgnnsqvsqnyhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >7jxsD (D:)
    vlsggeldkwekirlrpggkkqyklkhivwasrelerfavnpglletsegcrqilgrlqp
    slqtgseelrslyntiavlycvhqridvkdtkealdkieeeqn
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >7jxsE (E:)
    garasvlsggeldkwekirlrpggkkqyklkhivwasrelerfavnpglletsegcrqil
    grlqpslqtgseelrslyntiavlycvhqridvkdtkealdkieeeqnkskkkaqqaaad
    tgnnsqvsqnyhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >7jxsE (E:)
    vlsggeldkwekirlrpggkkqyklkhivwasrelerfavnpglletsegcrqilgrlqp
    slqtgseelrslyntiavlycvhqridvkdtkealdkieeeqnk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >7jxsF (F:)
    garasvlsggeldkwekirlrpggkkqyklkhivwasrelerfavnpglletsegcrqil
    grlqpslqtgseelrslyntiavlycvhqridvkdtkealdkieeeqnkskkkaqqaaad
    tgnnsqvsqnyhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >7jxsF (F:)
    vlsggeldkwekirlrpggkkqyklkhivwasrelerfavnpglletsegcrqilgrlqp
    slqtgseelrslyntiavlycvhqridvkdtkealdkieeeqnks