PDB entry 7jx2

View 7jx2 on RCSB PDB site
Description: Cellular retinol-binding protein 2 (CRBP2) in complex with 2-palmitoylglycerol
Class: lipid binding protein
Keywords: palmitoylglycerol, monoacylglycerol, retinol-binding protein, lipid binding, LIPID BINDING PROTEIN
Deposited on 2020-08-26, released 2021-03-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-04-07, with a file datestamp of 2021-04-02.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Retinol-binding protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: RBP2, CRBP2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P50120 (0-133)
      • expression tag (134)
    Domains in SCOPe 2.08: d7jx2a1, d7jx2a2
  • Heterogens: VLP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >7jx2A (A:)
mtrdqngtwemesnenfegymkaldidfatrkiavrltqtkvidqdgdnfktkttstfrn
ydvdftvgvefdeytksldnrhvkalvtwegdvlvcvqkgekenrgwkqwiegdklylel
tcgdqvcrqvfkkklvpr

    Sequence, based on observed residues (ATOM records): (download) 
    >7jx2A (A:)
mtrdqngtwemesnenfegymkaldidfatrkiavrltqtkvidqdgdnfktkttstfrn
ydvdftvgvefdeytksldnrhvkalvtwegdvlvcvqkgekenrgwkqwiegdklylel
tcgdqvcrqvfkkkl