PDB entry 7jub

View 7jub on RCSB PDB site
Description: C-type carbohydrate-recognition domain 4 of the mannose receptor complexed with methyl-mannoside
Class: sugar binding protein
Keywords: glycobiology, carbohydrate-binding protein, c-type lectin, complex, sugar binding protein
Deposited on 2020-08-19, released 2021-02-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-07-14, with a file datestamp of 2021-07-09.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: N/A
AEROSPACI score: 0.73 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Macrophage mannose receptor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: MRC1, CLEC13D, CLEC13DL, MRC1L1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22897 (1-134)
      • expression tag (0)
    Domains in SCOPe 2.08: d7juba_
  • Heterogens: CA, MMA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >7jubA (A:)
acpedwgassrtslcfklyakgkhekktwfesrdfcralggdlasinnkeeqqtiwrlit
asgsyhklfwlgltygspsegftwsdgspvsyenwaygepnnyqnveycgelkgdptmsw
ndincehlnnwicqi

    Sequence, based on observed residues (ATOM records): (download) 
    >7jubA (A:)
lcfklyakgkhekktwfesrdfcralggdlasinnkeeqqtiwrlitasgsyhklfwlgl
tygspsegftwsdgspvsyenwaygepnnyqnveycgelkgdptmswndincehlnnwic
qi