PDB entry 7jt4

View 7jt4 on RCSB PDB site
Description: Crystal Structure of BPTF bromodomain labelled with 5-fluoro-tryptophan
Class: gene regulation
Keywords: gene regulation, bptf
Deposited on 2020-08-17, released 2021-07-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-07-28, with a file datestamp of 2021-07-23.
Experiment type: XRAY
Resolution: 2.06 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nucleosome-remodeling factor subunit BPTF
    Species: Homo sapiens [TaxId:9606]
    Gene: BPTF, FAC1, FALZ
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q12830 (10-130)
      • expression tag (0-9)
    Domains in SCOPe 2.08: d7jt4a1, d7jt4a2
  • Heterogens: FTR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >7jt4A (A:)
gtenlyfqsmstedamtvltpltekdyeglkrvlrslqahkmawpflepvdpndapdyyg
vikepmdlatmeervqrryyekltefvadmtkifdncryynpsdspfyqcaevlesffvq
klkgfkasrsh

    Sequence, based on observed residues (ATOM records): (download) 
    >7jt4A (A:)
mstedamtvltpltekdyeglkrvlrslqahkmawpflepvdpndapdyygvikepmdla
tmeervqrryyekltefvadmtkifdncryynpsdspfyqcaevlesffvqklkgfkasr
sh