PDB entry 7jrj

View 7jrj on RCSB PDB site
Description: Chlamydomonas reinhardtii radial spoke head and neck (recombinant)
Class: structural protein
Keywords: Cilia, Radial spoke, Mechano-regulation, STRUCTURAL PROTEIN
Deposited on 2020-08-12, released 2020-12-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-01-27, with a file datestamp of 2021-01-22.
Experiment type: EM
Resolution: 3.03 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Radial spoke protein 9
  Species: Chlamydomonas reinhardtii [TaxId:3055]
  Gene: RSP9, CHLRE_07g330200v5, CHLREDRAFT_182960
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q27YU5 (Start-268)
• Chain 'B':
  Compound: Radial spoke protein 9
  Species: Chlamydomonas reinhardtii [TaxId:3055]
  Gene: RSP9, CHLRE_07g330200v5, CHLREDRAFT_182960
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q27YU5 (Start-268)
• Chain 'C':
  Compound: Flagellar radial spoke protein 4
  Species: Chlamydomonas reinhardtii [TaxId:3055]
  Gene: RSP4
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q01656
• Chain 'D':
  Compound: Flagellar radial spoke protein 6
  Species: Chlamydomonas reinhardtii [TaxId:3055]
  Gene: RSP6
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q01657
• Chain 'E':
  Compound: Radial spoke protein 10
  Species: Chlamydomonas reinhardtii [TaxId:3055]
  Gene: RSP10, CHLRE_01g005450v5, CHLREDRAFT_185792
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q27YU4
• Chain 'F':
  Compound: Flagellar radial spoke protein 1
  Species: Chlamydomonas reinhardtii [TaxId:3055]
  Gene: RSP1, CHLREDRAFT_196412
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q27YU0
• Chain 'G':
  Compound: Flagellar radial spoke protein 3
  Species: Chlamydomonas reinhardtii [TaxId:3055]
  Gene: RSP3
  Database cross-references and differences (RAF-indexed):
  • Uniprot P12759
• Chain 'H':
  Compound: Flagellar radial spoke protein 5
  Species: Chlamydomonas reinhardtii [TaxId:3055]
  Gene: RSP5, CHLREDRAFT_190792
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q27YU7
• Chain 'I':
  Compound: Flagellar radial spoke protein 2
  Species: Chlamydomonas reinhardtii [TaxId:3055]
  Gene: RSP2, CHLREDRAFT_186281
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q6UBQ3
• Chain 'J':
  Compound: unknown protein
  Species: Chlamydomonas reinhardtii [TaxId:3055]
  Database cross-references and differences (RAF-indexed):
  • PDB 7JRJ (0-3)
• Chain 'K':
  Compound: Nucleoside diphosphate kinase 6
  Species: Chlamydomonas reinhardtii [TaxId:3055]
  Gene: RSP23, CHLRE_16g654300v5, CHLREDRAFT_139197
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q69B19
  Domains in SCOPe 2.08: d7jrjk_
• Chain 'L':
  Compound: Flagellar radial spoke protein 6
  Species: Chlamydomonas reinhardtii [TaxId:3055]
  Database cross-references and differences (RAF-indexed):
  • PDB 7JRJ (0-5)
• Chain 'M':
  Compound: Flagellar radial spoke protein 10
  Species: Chlamydomonas reinhardtii [TaxId:3055]
  Database cross-references and differences (RAF-indexed):
  • PDB 7JRJ (0-4)
• Chain 'N':
  Compound: Flagellar radial spoke protein 1
  Species: Chlamydomonas reinhardtii [TaxId:3055]
  Database cross-references and differences (RAF-indexed):
  • PDB 7JRJ (0-88)
• Chain 'O':
  Compound: Flagellar radial spoke protein 2
  Species: Chlamydomonas reinhardtii [TaxId:3055]
  Database cross-references and differences (RAF-indexed):
  • PDB 7JRJ (0-68)

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  No sequence available.
  
  
• Chain 'E':
  No sequence available.
  
  
• Chain 'F':
  No sequence available.
  
  
• Chain 'G':
  No sequence available.
  
  
• Chain 'H':
  No sequence available.
  
  
• Chain 'I':
  No sequence available.
  
  
• Chain 'J':
  No sequence available.
  
  
• Chain 'K':
  Sequence, based on SEQRES records: (download)
  

  >7jrjK (K:)
  maelektfalikpdavragkaqeimqlielngftiiakqklqltraraeefygehkgkef
  fpklvnfmtsgpiwalvlakpgailawralmgptnvfkaraeqpkclralygtdgtqnat
  hgsdspisaareikfffptlsgdptiyaeptaaaeyitkriqpalakalaalarekpsad
  kfeaitfvagyllqnnpnkpkvlmpdewdpalmgddeddeadfinarlaaptgndgatka
  efdamveaakadtggaapaqefvypdskpttpvvpappapgskppsasgarpqsarptsa
  rppsasaappaplapvpppasssrpasgsgrppsatarppsatppppppaveleeaddpa
  qldeaatkvqaafrgyqarkevavmrseaqpgeaaaepeqeaelqpeaepepqpegeqep
  qpqasasssflpdgvteemaaeaatrvqahmrghlarkqvaaikaqqaapavaesseala
  epepqpeaeaepqpqasvsssflpdgvteemaaeaatlvqahmrghlarkqvaaikaqqa
  apavaesseaqaeaeqteaeaepqpdaeaeagaaegeaepepeaae
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >7jrjK (K:)
  lektfalikpdavragkaqeimqlielngftiiakqklqltraraeefygehkgkeffpk
  lvnfmtsgpiwalvlakpgailawralmgptnvfkaraeqpkclralygtdgtqnathgs
  dspisaareikfffptlsgdptiyaeptaaaeyitkri
  

  
  
• Chain 'L':
  No sequence available.
  
  
• Chain 'M':
  No sequence available.
  
  
• Chain 'N':
  No sequence available.
  
  
• Chain 'O':
  No sequence available.