PDB entry 7jqo

View 7jqo on RCSB PDB site
Description: Crystal structure of the R64D mutant of Bauhinia Bauhinioides Kallikrein Inhibitor complexed with Human Kallikrein 4
Class: structural protein, hydrolase/inhibitor
Keywords: Human Kallikrein 4, Bauhinia Bauhiniordes Kallikrein Inhibitor, STRUCTURAL PROTEIN, HYDROLASE-INHIBITOR complex
Deposited on 2020-08-11, released 2021-07-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-07-21, with a file datestamp of 2021-07-16.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Compound: Kallikrein-4
    Species: Homo sapiens [TaxId:9606]
    Gene: KLK4, EMSP1, PRSS17, PSTS
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y5K2 (0-222)
      • variant (165)
    Domains in SCOPe 2.08: d7jqoe_
  • Chain 'I':
    Compound: Kunitz-type inihibitor
    Species: Bauhinia bauhinioides [TaxId:166014]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6VEQ7 (1-165)
      • expression tag (0)
      • engineered mutation (64)
  • Heterogens: 2PE, CD, SO4, CL, HOH

PDB Chain Sequences:

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >7jqoE (E:)
iingedcsphsqpwqaalvmenelfcsgvlvhpqwvlsaahcfqnsytiglglhsleadq
epgsqmveaslsvrhpeynrpllandlmlikldesvsesdtirsisiasqcptagnsclv
sgwgllangrmptvlqcvnvsvvseevcsklydplyhpsmfcagggqdqkdscngdsggp
licngylqglvsfgkapcgqvgvpgvytnlckftewiektvqa

  • Chain 'I':
    No sequence available.