PDB entry 7jot

View 7jot on RCSB PDB site
Description: Adeno-associated virus strain AAV7 capsid icosahedral structure
Class: virus
Keywords: AAV, parvovirus, Parvoviridae, adeno-associated virus, capsid, VIRUS
Deposited on 2020-08-07, released 2020-10-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-10-07, with a file datestamp of 2020-10-02.
Experiment type: EM
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: capsid protein
    Species: Adeno-associated virus - 7 [TaxId:202812]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d7jota_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >7jotA (A:)
    dgvgnasgnwhcdstwlgdrvittstrtwalptynnhlykqissetagstndntyfgyst
    pwgyfdfnrfhchfsprdwqrlinnnwgfrpkklrfklfniqvkevttndgvttiannlt
    stiqvfsdseyqlpyvlgsahqgclppfpadvfmipqygyltlnngsqsvgrssfycley
    fpsqmlrtgnnfefsysfedvpfhssyahsqsldrlmnplidqylyylartqsnpggtag
    nrelqfyqggpstmaeqaknwlpgpcfrqqrvsktldqnnnsnfawtgatkyhlngrnsl
    vnpgvamathkddedrffpssgvlifgktgatnkttlenvlmtneeeirptnpvateeyg
    ivssnlqaantaaqtqvvnnqgalpgmvwqnrdvylqgpiwakiphtdgnfhpsplmggf
    glkhpppqilikntpvpanppevftpakfasfitqystgqvsveiewelqkenskrwnpe
    iqytsnfekqtgvdfavdsqgvyseprpigtryltrnl