PDB entry 7jo8

View 7jo8 on RCSB PDB site
Description: crystal structure of a chimeric antigen receptor (car) scfv domain rearrangement forming a vl-vl dimer
Deposited on 2020-08-06, released 2021-02-10
The last revision was dated 2021-02-10, with a file datestamp of 2021-02-05.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 47g4-cd828z
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 7JO8
  • Chain 'B':
    Compound: 47g4-cd828z
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 7JO8 (0-109)
  • Heterogens: 1PE, MLI, PG4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >7jo8A (A:)
eivltqspgtlslspgeratlscrasqsvsssylawyqqkpgqaprlliygassratgip
drfsgsgsgtdftltisrlepedfavyycqqygssrftfgpgtkvdikgs

    Sequence, based on observed residues (ATOM records):
    >7jo8A (A:)
ivltqspgtlslspgeratlscrasqsvsssylawyqqkpgqaprlliygassratgipd
rfsgsgsgtdftltisrlepedfavyycqqygssrftfgpgtkvdik

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >7jo8B (B:)
eivltqspgtlslspgeratlscrasqsvsssylawyqqkpgqaprlliygassratgip
drfsgsgsgtdftltisrlepedfavyycqqygssrftfgpgtkvdikgs