PDB entry 7jmk

View 7jmk on RCSB PDB site
Description: GTP-specific succinyl-CoA synthetase complexed with Mg-GDP in space group P32
Class: ligase
Keywords: Complex, LIGASE
Deposited on 2020-08-01, released 2021-03-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2021-03-10, with a file datestamp of 2021-03-05.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial
    Species: Sus scrofa [TaxId:9823]
    Gene: SUCLG1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d7jmka1, d7jmka2
  • Chain 'B':
    Compound: Succinate--CoA ligase [GDP-forming] subunit beta, mitochondrial
    Species: Sus scrofa [TaxId:9823]
    Gene: SUCLG2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P53590 (1-End)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d7jmkb1, d7jmkb2
  • Chain 'C':
    Compound: Succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial
    Species: Sus scrofa [TaxId:9823]
    Gene: SUCLG1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d7jmkc1, d7jmkc2
  • Chain 'D':
    Compound: Succinyl-CoA ligase [GDP-forming] subunit beta, mitochondrial
    Species: Sus scrofa [TaxId:9823]
    Gene: SUCLG2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P53590 (1-End)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d7jmkd1, d7jmkd2
  • Heterogens: GDP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >7jmkA (A:)
    sytasrkhlyvdkntkvicqgftgkqgtfhsqqaleygtnlvggttpgkggkthlglpvf
    ntvkeakeqtgatasviyvpppfaaaaineaidaevplvvcitegipqqdmvrvkhrllr
    qgktrligpncpgvinpgeckigimpghihkkgrigivsrsgtltyeavhqttqvglgqs
    lcvgiggdpfngtdftdcleiflndpategiiligeiggnaeenaaeflkqhnsgpkskp
    vvsfiagltappgrrmghagaiiaggkggakekitalqsagvvvsmspaqlgttiykefe
    krkml
    

    Sequence, based on observed residues (ATOM records): (download)
    >7jmkA (A:)
    sytasrkhlyvdkntkvicqgftgkqgtfhsqqaleygtnlvggttpgkggkthlglpvf
    ntvkeakeqtgatasviyvpppfaaaaineaidaevplvvcitegipqqdmvrvkhrllr
    qgktrligpncpgvinpgeckigimpghihkkgrigivsrsgtltyeavhqttqvglgqs
    lcvgiggdpfngtdftdcleiflndpategiiligeiggnaeenaaeflkqhnsgpkskp
    vvsfiagltappmghagaiigakekitalqsagvvvsmspaqlgttiykefekrkml
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >7jmkB (B:)
    mnlqeyqskklmsdngvkvqrffvadtanealeaakrlnakeivlkaqilaggrgkgvfs
    sglkggvhltkdpevvgqlakqmigynlatkqtpkegvkvnkvmvaealdisretylail
    mdrscngpvlvgspqggvdieevaasnpelifkeqidiiegikdsqaqrmaenlgflgpl
    qnqaadqikklynlflkidatqvevnpfgetpegqvvcfdakinfddnaefrqkdifamd
    dksenepieneaakydlkyigldgniacfvngaglamatcdiiflnggkpanfldlgggv
    kesqvyqafklltadpkveailvnifggivncaiiangitkacrelelkvplvvrlegtn
    vheaqniltnsglpitsavdledaakkavasvtkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >7jmkB (B:)
    mnlqeyqskklmsdngvkvqrffvadtanelnakeivlkaqilaggrglkggvhltkdpe
    vvgqlakqmigynlatkqtpkegvkvnkvmvaealdisretylailmdrscngpvlvgsp
    qggvdieevaasnpelifkeqidiiegikdsqaqrmaenlgflgplqnqaadqikklynl
    flkidatqvevnpfgetpegqvvcfdakinfddnaefrqkdifamddksenepieneaak
    ydlkyigldgniacfvngaglamatcdiiflnggkpanfldlgggvkesqvyqafkllta
    dpkveailvnifggivncaiiangitkacrelelkvplvvrlegtnvheaqniltnsglp
    itsavdledaakkavasvt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >7jmkC (C:)
    sytasrkhlyvdkntkvicqgftgkqgtfhsqqaleygtnlvggttpgkggkthlglpvf
    ntvkeakeqtgatasviyvpppfaaaaineaidaevplvvcitegipqqdmvrvkhrllr
    qgktrligpncpgvinpgeckigimpghihkkgrigivsrsgtltyeavhqttqvglgqs
    lcvgiggdpfngtdftdcleiflndpategiiligeiggnaeenaaeflkqhnsgpkskp
    vvsfiagltappgrrmghagaiiaggkggakekitalqsagvvvsmspaqlgttiykefe
    krkml
    

    Sequence, based on observed residues (ATOM records): (download)
    >7jmkC (C:)
    sytasrkhlyvdkntkvicqgftgkqgtfhsqqaleygtnlvggttpgkggkthlglpvf
    ntvkeakeqtgatasviyvpppfaaaaineaidaevplvvcitegipqqdmvrvkhrllr
    qgktrligpncpgvinpgeckigimpghihkkgrigivsrsgtltyeavhqttqvglgqs
    lcvgiggdpfngtdftdcleiflndpategiiligeiggnaeenaaeflkqhnsgpkskp
    vvsfiagltappgagaiikggakekitalqsagvvvsmspaqlgttiykefekrkml
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >7jmkD (D:)
    mnlqeyqskklmsdngvkvqrffvadtanealeaakrlnakeivlkaqilaggrgkgvfs
    sglkggvhltkdpevvgqlakqmigynlatkqtpkegvkvnkvmvaealdisretylail
    mdrscngpvlvgspqggvdieevaasnpelifkeqidiiegikdsqaqrmaenlgflgpl
    qnqaadqikklynlflkidatqvevnpfgetpegqvvcfdakinfddnaefrqkdifamd
    dksenepieneaakydlkyigldgniacfvngaglamatcdiiflnggkpanfldlgggv
    kesqvyqafklltadpkveailvnifggivncaiiangitkacrelelkvplvvrlegtn
    vheaqniltnsglpitsavdledaakkavasvtkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >7jmkD (D:)
    mnlqeyqskklmsdngvkvqrffvlnakekaqilagkgvfssglkgynlatkqtpkegvk
    vnkvmvaealdisretylailmdrscngpvlvgspqggvdieevaasnpelifkeqidii
    egikdsqaqrmaenlgflgplqnqaadqikklynlflkidatqvevnpfgetpegqvvcf
    dakinfddnaefrqkdifamddksenepieneaakydlkyigldgniacfvngaglamat
    cdiiflnggkpanfldlgggvkesqvyqafklltadpkveailvnifggivncaiiangi
    tkacrelelkvplvvrlegtnvheaqniltnsglpitsavdledaakkavasvt