PDB entry 7jm3

View 7jm3 on RCSB PDB site
Description: full-length three-dimensional structure of the influenza a virus m1 protein and its organization into a matrix layer
Deposited on 2020-07-30, released 2020-08-12
The last revision was dated 2020-10-14, with a file datestamp of 2020-10-09.
Experiment type: EM
Resolution: 3.4 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'C':
    Compound: matrix protein 1
    Species: Influenza A virus (strain A/Puerto Rico/8/1934 H1N1) [TaxId:211044]
    Gene: M1, M
    Database cross-references and differences (RAF-indexed):
    • Uniprot H2KIU5 (0-250)
      • engineered mutation (95)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records:
    >7jm3C (C:)
slltevetyvlsiipsgplkaeiaqrledvfagkntdlevlmewlktrpilspltkgilg
fvftltvpserglqrrrfvqnalngngdpnnmdkakklyrklkreitfhgakeislsysa
galascmgliynrmgavttevafglvcatceqiadsqhrshrqmvtttnplirhenrmvl
asttakameqmagsseqaaeamevasqarqmvqamrtigthpsssaglkndllenlqayq
krmgvqmqrfk