PDB entry 7jfl

View 7jfl on RCSB PDB site
Description: Crystal structure of human phosphorylated IRF-3 bound to CBP
Class: immune system
Keywords: transcription factor, phosphorylation, innate immunity, IMMUNE SYSTEM
Deposited on 2020-07-17, released 2020-09-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-10-07, with a file datestamp of 2020-10-02.
Experiment type: XRAY
Resolution: 1.68 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Interferon regulatory factor 3
    Species: Homo sapiens [TaxId:9606]
    Gene: IRF3
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Interferon regulatory factor 3
    Species: Homo sapiens [TaxId:9606]
    Gene: IRF3
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: creb-binding protein
    Species: Homo sapiens [TaxId:9606]
    Gene: CREBBP, CBP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d7jflc_
  • Chain 'D':
    Compound: creb-binding protein
    Species: Homo sapiens [TaxId:9606]
    Gene: CREBBP, CBP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d7jfld_
  • Heterogens: SEP, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >7jflC (C:)
    salqdllrtlkspsspqqqqqvlnilksnpqlmaafikqrtakyvan
    

    Sequence, based on observed residues (ATOM records): (download)
    >7jflC (C:)
    dllrtlkspsspqqqqqvlnilksnpqlmaafikqr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >7jflD (D:)
    salqdllrtlkspsspqqqqqvlnilksnpqlmaafikqrtakyvan
    

    Sequence, based on observed residues (ATOM records): (download)
    >7jflD (D:)
    alqdllrtlkspsspqqqqqvlnilksnpqlmaafikq