PDB entry 7ins
View 7ins on RCSB PDB site
Description: structure of porcine insulin cocrystallized with clupeine z
Deposited on
1991-09-03, released
1994-01-31
The last revision prior to the SCOP 1.61 freeze date was dated
1994-01-31, with a file datestamp of
1994-01-31.
Experiment type: -
Resolution: 2 Å
R-factor: 0.194
AEROSPACI score: 0.38
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Domains in SCOP 1.61: d7ins.1 - Chain 'B':
Domains in SCOP 1.61: d7ins.1 - Chain 'C':
Domains in SCOP 1.61: d7ins.2 - Chain 'D':
Domains in SCOP 1.61: d7ins.2 - Chain 'E':
Domains in SCOP 1.61: d7ins.3 - Chain 'F':
Domains in SCOP 1.61: d7ins.3
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>7insA (A:)
giveqcctsicslyqlenycn
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>7insB (B:)
fvnqhlcgshlvealylvcgergffytpka
- Chain 'C':
Sequence; same for both SEQRES and ATOM records: (download)
>7insC (C:)
giveqcctsicslyqlenycn
- Chain 'D':
Sequence; same for both SEQRES and ATOM records: (download)
>7insD (D:)
fvnqhlcgshlvealylvcgergffytpka
- Chain 'E':
Sequence; same for both SEQRES and ATOM records: (download)
>7insE (E:)
giveqcctsicslyqlenycn
- Chain 'F':
Sequence; same for both SEQRES and ATOM records: (download)
>7insF (F:)
fvnqhlcgshlvealylvcgergffytpka