PDB entry 7ins

View 7ins on RCSB PDB site
Description: structure of porcine insulin cocrystallized with clupeine z
Deposited on 1991-09-03, released 1994-01-31
The last revision prior to the SCOP 1.59 freeze date was dated 1994-01-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2 Å
R-factor: 0.194
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d7ins.1
  • Chain 'B':
    Domains in SCOP 1.59: d7ins.1
  • Chain 'C':
    Domains in SCOP 1.59: d7ins.2
  • Chain 'D':
    Domains in SCOP 1.59: d7ins.2
  • Chain 'E':
    Domains in SCOP 1.59: d7ins.3
  • Chain 'F':
    Domains in SCOP 1.59: d7ins.3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >7insA (A:)
giveqcctsicslyqlenycn

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >7insB (B:)
fvnqhlcgshlvealylvcgergffytpka

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >7insC (C:)
giveqcctsicslyqlenycn

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >7insD (D:)
fvnqhlcgshlvealylvcgergffytpka

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >7insE (E:)
giveqcctsicslyqlenycn

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >7insF (F:)
fvnqhlcgshlvealylvcgergffytpka