PDB entry 7ins

View 7ins on RCSB PDB site
Description: structure of porcine insulin cocrystallized with clupeine z
Class: hormone
Keywords: hormone
Deposited on 1991-09-03, released 1994-01-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.194
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: insulin (chain a)
  Species: Sus scrofa [TaxId:9823]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01315 (0-20)
  Domains in SCOPe 2.08: d7ins.1
• Chain 'B':
  Compound: insulin (chain b)
  Species: Sus scrofa [TaxId:9823]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01315 (0-29)
  Domains in SCOPe 2.08: d7ins.1
• Chain 'C':
  Compound: insulin (chain a)
  Species: Sus scrofa [TaxId:9823]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01315 (0-20)
  Domains in SCOPe 2.08: d7ins.2
• Chain 'D':
  Compound: insulin (chain b)
  Species: Sus scrofa [TaxId:9823]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01315 (0-29)
  Domains in SCOPe 2.08: d7ins.2
• Chain 'E':
  Compound: insulin (chain a)
  Species: Sus scrofa [TaxId:9823]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01315 (0-20)
  Domains in SCOPe 2.08: d7ins.3
• Chain 'F':
  Compound: insulin (chain b)
  Species: Sus scrofa [TaxId:9823]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01315 (0-29)
  Domains in SCOPe 2.08: d7ins.3
• Chain 'G':
  Compound: general protamine chain
  Database cross-references and differences (RAF-indexed):
  • PDB 7INS (0-15)
• Heterogens: ZN, UNK, CRS, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >7insA (A:)
  giveqcctsicslyqlenycn
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >7insB (B:)
  fvnqhlcgshlvealylvcgergffytpka
  

  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >7insC (C:)
  giveqcctsicslyqlenycn
  

  
  
• Chain 'D':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >7insD (D:)
  fvnqhlcgshlvealylvcgergffytpka
  

  
  
• Chain 'E':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >7insE (E:)
  giveqcctsicslyqlenycn
  

  
  
• Chain 'F':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >7insF (F:)
  fvnqhlcgshlvealylvcgergffytpka
  

  
  
• Chain 'G':
  No sequence available.