PDB entry 7i1b

View 7i1b on RCSB PDB site
Description: high-resolution three-dimensional structure of interleukin-1 beta in solution by three-and four-dimensional nuclear magnetic resonance spectroscopy
Deposited on 1991-01-22, released 1992-10-15
The last revision prior to the SCOP 1.67 freeze date was dated 1992-10-15, with a file datestamp of 1994-01-31.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.67: d7i1b__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >7i1b_ (-)
  apvrslnctlrdsqqkslvmsgpyelkalhlqgqdmeqqvvfsmsfvqgeesndkipval
  glkeknlylscvlkddkptlqlesvdpknypkkkmekrfvfnkieinnklefesaqfpnw
  yistsqaenmpvflggtkggqditdftmqfvss