PDB entry 7hsc

View 7hsc on RCSB PDB site
Description: high resolution solution structure of the heat shock cognate-70 kd substrate binding domain obtained by multidimensional nmr techniques
Class: molecular chaperone
Keywords: molecular chaperone, hsp70, peptide binding, protein folding
Deposited on 1999-05-03, released 1999-05-10
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (heat shock cognate 70 kd protein 1)
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d7hsca_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >7hscA (A:)
senvqdlllldvtplslgietaggvmtvlikrnttiptkqtqtfttysdnqpgvliqvye
geramtkdnnllgkfeltgippaprgvpqievtfdidangilnvsavdkstgkenkitit
ndkgrlskediermvqeaekykaedekqrdkvssknsle