PDB entry 7gpb

View 7gpb on RCSB PDB site
Description: structural mechanism for glycogen phosphorylase control by phosphorylation and amp
Class: glycogen phosphorylase
Keywords: glycogen phosphorylase
Deposited on 1990-11-13, released 1992-10-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glycogen phosphorylase b
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00489
      • conflict (379)
    Domains in SCOPe 2.07: d7gpba_
  • Chain 'B':
    Compound: glycogen phosphorylase b
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00489
      • conflict (379)
    Domains in SCOPe 2.07: d7gpbb_
  • Chain 'C':
    Compound: glycogen phosphorylase b
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00489
      • conflict (379)
    Domains in SCOPe 2.07: d7gpbc_
  • Chain 'D':
    Compound: glycogen phosphorylase b
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00489
      • conflict (379)
    Domains in SCOPe 2.07: d7gpbd_
  • Heterogens: SO4, PLP, AMP

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >7gpbA (A:)
    srplsdqekrkqisvrglagvenvtelkknfnrhlhftlvkdrnvatprdyyfalahtvr
    dhlvgrwirtqqhyyekdpkriyylslefymgrtlqntmvnlalenacdeatyqlgldme
    eleeieedaglgngglgrlaacfldsmatlglaaygygiryefgifnqkicggwqmeead
    dwlrygnpwekarpeftlpvhfygrvehtsqgakwvdtqvvlampydtpvpgyrnnvvnt
    mrlwsakapndfnlkdfnvggyiqavldrnlaenisrvlypndnffegkelrlkqeyfvv
    aatlqdiirrfksskfgcrdpvrtnfdafpdkvaiqlndthpslaipelmrvlvdlerld
    wdkawevtvktcaytnhtvipealerwpvhlletllprhlqiiyeinqrflnrvaaafpg
    dvdrlrrmslveegavkrinmahlciagshavngvarihseilkktifkdfyelephkfq
    nktngitprrwlvlcnpglaeiiaerigeeyisdldqlrkllsyvddeafirdvakvkqe
    nklkfaaylereykvhinpnslfdvqvkriheykrqllnclhvitlynrikkepnkfvvp
    rtvmiggkaapgyhmakmiiklitaigdvvnhdpvvgdrlrviflenyrvslaekvipaa
    dlseqistagteasgtgnmkfmlngaltigtmdganvemaeeageenffifgmrvedvdr
    ldqrgynaqeyydripelrqiieqlssgffspkqpdlfkdivnmlmhhdrfkvfadyeey
    vkcqervsalyknprewtrmvirniatsgkfssdrtiaqyareiwgvepsrqrlpapdek
    ip
    

    Sequence, based on observed residues (ATOM records): (download)
    >7gpbA (A:)
    rkqisvrglagvenvtelkknfnrhlhftlvkdrnvatprdyyfalahtvrdhlvgrwir
    tqqhyyekdpkriyylslefymgrtlqntmvnlalenacdeatyqlgldmeeleeieeda
    glgngglgrlaacfldsmatlglaaygygiryefgifnqkicggwqmeeaddwlrygnpw
    ekarpeftlpvhfygrvehtsqgakwvdtqvvlampydtpvpgyrnnvvntmrlwsakap
    ndfnlkdfnvggyiqavldrnlaenisrvlypnegkelrlkqeyfvvaatlqdiirrfks
    skfgcrdpvrtnfdafpdkvaiqlndthpslaipelmrvlvdlerldwdkawevtvktca
    ytnhtvipealerwpvhlletllprhlqiiyeinqrflnrvaaafpgdvdrlrrmslvee
    gavkrinmahlciagshavngvarihseilkktifkdfyelephkfqnktngitprrwlv
    lcnpglaeiiaerigeeyisdldqlrkllsyvddeafirdvakvkqenklkfaaylerey
    kvhinpnslfdvqvkriheykrqllnclhvitlynrikkepnkfvvprtvmiggkaapgy
    hmakmiiklitaigdvvnhdpvvgdrlrviflenyrvslaekvipaadlseqistagtea
    sgtgnmkfmlngaltigtmdganvemaeeageenffifgmrvedvdrldqrgynaqeyyd
    ripelrqiieqlssgffspkqpdlfkdivnmlmhhdrfkvfadyeeyvkcqervsalykn
    prewtrmvirniatsgkfssdrtiaqyareiwgvepsrqrlpap
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >7gpbB (B:)
    srplsdqekrkqisvrglagvenvtelkknfnrhlhftlvkdrnvatprdyyfalahtvr
    dhlvgrwirtqqhyyekdpkriyylslefymgrtlqntmvnlalenacdeatyqlgldme
    eleeieedaglgngglgrlaacfldsmatlglaaygygiryefgifnqkicggwqmeead
    dwlrygnpwekarpeftlpvhfygrvehtsqgakwvdtqvvlampydtpvpgyrnnvvnt
    mrlwsakapndfnlkdfnvggyiqavldrnlaenisrvlypndnffegkelrlkqeyfvv
    aatlqdiirrfksskfgcrdpvrtnfdafpdkvaiqlndthpslaipelmrvlvdlerld
    wdkawevtvktcaytnhtvipealerwpvhlletllprhlqiiyeinqrflnrvaaafpg
    dvdrlrrmslveegavkrinmahlciagshavngvarihseilkktifkdfyelephkfq
    nktngitprrwlvlcnpglaeiiaerigeeyisdldqlrkllsyvddeafirdvakvkqe
    nklkfaaylereykvhinpnslfdvqvkriheykrqllnclhvitlynrikkepnkfvvp
    rtvmiggkaapgyhmakmiiklitaigdvvnhdpvvgdrlrviflenyrvslaekvipaa
    dlseqistagteasgtgnmkfmlngaltigtmdganvemaeeageenffifgmrvedvdr
    ldqrgynaqeyydripelrqiieqlssgffspkqpdlfkdivnmlmhhdrfkvfadyeey
    vkcqervsalyknprewtrmvirniatsgkfssdrtiaqyareiwgvepsrqrlpapdek
    ip
    

    Sequence, based on observed residues (ATOM records): (download)
    >7gpbB (B:)
    rkqisvrglagvenvtelkknfnrhlhftlvkdrnvatprdyyfalahtvrdhlvgrwir
    tqqhyyekdpkriyylslefymgrtlqntmvnlalenacdeatyqlgldmeeleeieeda
    glgngglgrlaacfldsmatlglaaygygiryefgifnqkicggwqmeeaddwlrygnpw
    ekarpeftlpvhfygrvehtsqgakwvdtqvvlampydtpvpgyrnnvvntmrlwsakap
    ndfnlkdfnvggyiqavldrnlaenisrvlypnegkelrlkqeyfvvaatlqdiirrfks
    skfgcrdpvrtnfdafpdkvaiqlndthpslaipelmrvlvdlerldwdkawevtvktca
    ytnhtvipealerwpvhlletllprhlqiiyeinqrflnrvaaafpgdvdrlrrmslvee
    gavkrinmahlciagshavngvarihseilkktifkdfyelephkfqnktngitprrwlv
    lcnpglaeiiaerigeeyisdldqlrkllsyvddeafirdvakvkqenklkfaaylerey
    kvhinpnslfdvqvkriheykrqllnclhvitlynrikkepnkfvvprtvmiggkaapgy
    hmakmiiklitaigdvvnhdpvvgdrlrviflenyrvslaekvipaadlseqistagtea
    sgtgnmkfmlngaltigtmdganvemaeeageenffifgmrvedvdrldqrgynaqeyyd
    ripelrqiieqlssgffspkqpdlfkdivnmlmhhdrfkvfadyeeyvkcqervsalykn
    prewtrmvirniatsgkfssdrtiaqyareiwgvepsrqrlpap
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >7gpbC (C:)
    srplsdqekrkqisvrglagvenvtelkknfnrhlhftlvkdrnvatprdyyfalahtvr
    dhlvgrwirtqqhyyekdpkriyylslefymgrtlqntmvnlalenacdeatyqlgldme
    eleeieedaglgngglgrlaacfldsmatlglaaygygiryefgifnqkicggwqmeead
    dwlrygnpwekarpeftlpvhfygrvehtsqgakwvdtqvvlampydtpvpgyrnnvvnt
    mrlwsakapndfnlkdfnvggyiqavldrnlaenisrvlypndnffegkelrlkqeyfvv
    aatlqdiirrfksskfgcrdpvrtnfdafpdkvaiqlndthpslaipelmrvlvdlerld
    wdkawevtvktcaytnhtvipealerwpvhlletllprhlqiiyeinqrflnrvaaafpg
    dvdrlrrmslveegavkrinmahlciagshavngvarihseilkktifkdfyelephkfq
    nktngitprrwlvlcnpglaeiiaerigeeyisdldqlrkllsyvddeafirdvakvkqe
    nklkfaaylereykvhinpnslfdvqvkriheykrqllnclhvitlynrikkepnkfvvp
    rtvmiggkaapgyhmakmiiklitaigdvvnhdpvvgdrlrviflenyrvslaekvipaa
    dlseqistagteasgtgnmkfmlngaltigtmdganvemaeeageenffifgmrvedvdr
    ldqrgynaqeyydripelrqiieqlssgffspkqpdlfkdivnmlmhhdrfkvfadyeey
    vkcqervsalyknprewtrmvirniatsgkfssdrtiaqyareiwgvepsrqrlpapdek
    ip
    

    Sequence, based on observed residues (ATOM records): (download)
    >7gpbC (C:)
    rkqisvrglagvenvtelkknfnrhlhftlvkdrnvatprdyyfalahtvrdhlvgrwir
    tqqhyyekdpkriyylslefymgrtlqntmvnlalenacdeatyqlgldmeeleeieeda
    glgngglgrlaacfldsmatlglaaygygiryefgifnqkicggwqmeeaddwlrygnpw
    ekarpeftlpvhfygrvehtsqgakwvdtqvvlampydtpvpgyrnnvvntmrlwsakap
    ndfnlkdfnvggyiqavldrnlaenisrvlypnegkelrlkqeyfvvaatlqdiirrfks
    skfgcrdpvrtnfdafpdkvaiqlndthpslaipelmrvlvdlerldwdkawevtvktca
    ytnhtvipealerwpvhlletllprhlqiiyeinqrflnrvaaafpgdvdrlrrmslvee
    gavkrinmahlciagshavngvarihseilkktifkdfyelephkfqnktngitprrwlv
    lcnpglaeiiaerigeeyisdldqlrkllsyvddeafirdvakvkqenklkfaaylerey
    kvhinpnslfdvqvkriheykrqllnclhvitlynrikkepnkfvvprtvmiggkaapgy
    hmakmiiklitaigdvvnhdpvvgdrlrviflenyrvslaekvipaadlseqistagtea
    sgtgnmkfmlngaltigtmdganvemaeeageenffifgmrvedvdrldqrgynaqeyyd
    ripelrqiieqlssgffspkqpdlfkdivnmlmhhdrfkvfadyeeyvkcqervsalykn
    prewtrmvirniatsgkfssdrtiaqyareiwgvepsrqrlpap
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >7gpbD (D:)
    srplsdqekrkqisvrglagvenvtelkknfnrhlhftlvkdrnvatprdyyfalahtvr
    dhlvgrwirtqqhyyekdpkriyylslefymgrtlqntmvnlalenacdeatyqlgldme
    eleeieedaglgngglgrlaacfldsmatlglaaygygiryefgifnqkicggwqmeead
    dwlrygnpwekarpeftlpvhfygrvehtsqgakwvdtqvvlampydtpvpgyrnnvvnt
    mrlwsakapndfnlkdfnvggyiqavldrnlaenisrvlypndnffegkelrlkqeyfvv
    aatlqdiirrfksskfgcrdpvrtnfdafpdkvaiqlndthpslaipelmrvlvdlerld
    wdkawevtvktcaytnhtvipealerwpvhlletllprhlqiiyeinqrflnrvaaafpg
    dvdrlrrmslveegavkrinmahlciagshavngvarihseilkktifkdfyelephkfq
    nktngitprrwlvlcnpglaeiiaerigeeyisdldqlrkllsyvddeafirdvakvkqe
    nklkfaaylereykvhinpnslfdvqvkriheykrqllnclhvitlynrikkepnkfvvp
    rtvmiggkaapgyhmakmiiklitaigdvvnhdpvvgdrlrviflenyrvslaekvipaa
    dlseqistagteasgtgnmkfmlngaltigtmdganvemaeeageenffifgmrvedvdr
    ldqrgynaqeyydripelrqiieqlssgffspkqpdlfkdivnmlmhhdrfkvfadyeey
    vkcqervsalyknprewtrmvirniatsgkfssdrtiaqyareiwgvepsrqrlpapdek
    ip
    

    Sequence, based on observed residues (ATOM records): (download)
    >7gpbD (D:)
    rkqisvrglagvenvtelkknfnrhlhftlvkdrnvatprdyyfalahtvrdhlvgrwir
    tqqhyyekdpkriyylslefymgrtlqntmvnlalenacdeatyqlgldmeeleeieeda
    glgngglgrlaacfldsmatlglaaygygiryefgifnqkicggwqmeeaddwlrygnpw
    ekarpeftlpvhfygrvehtsqgakwvdtqvvlampydtpvpgyrnnvvntmrlwsakap
    ndfnlkdfnvggyiqavldrnlaenisrvlypnegkelrlkqeyfvvaatlqdiirrfks
    skfgcrdpvrtnfdafpdkvaiqlndthpslaipelmrvlvdlerldwdkawevtvktca
    ytnhtvipealerwpvhlletllprhlqiiyeinqrflnrvaaafpgdvdrlrrmslvee
    gavkrinmahlciagshavngvarihseilkktifkdfyelephkfqnktngitprrwlv
    lcnpglaeiiaerigeeyisdldqlrkllsyvddeafirdvakvkqenklkfaaylerey
    kvhinpnslfdvqvkriheykrqllnclhvitlynrikkepnkfvvprtvmiggkaapgy
    hmakmiiklitaigdvvnhdpvvgdrlrviflenyrvslaekvipaadlseqistagtea
    sgtgnmkfmlngaltigtmdganvemaeeageenffifgmrvedvdrldqrgynaqeyyd
    ripelrqiieqlssgffspkqpdlfkdivnmlmhhdrfkvfadyeeyvkcqervsalykn
    prewtrmvirniatsgkfssdrtiaqyareiwgvepsrqrlpap