PDB entry 7gat

View 7gat on RCSB PDB site
Description: solution nmr structure of the l22v mutant DNA binding domain of area complexed to a 13 bp DNA containing a tgata site, 34 structures
Class: transcription/DNA
Keywords: DNA binding protein, transcription factor, zinc binding domain, complex (transcription regulation/DNA), transcription/DNA complex
Deposited on 1997-11-07, released 1998-01-28
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-12.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nitrogen regulatory protein area
    Species: Emericella nidulans [TaxId:162425]
    Gene: POTENTIAL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17429 (0-65)
      • conflict (0)
      • engineered (21)
    Domains in SCOPe 2.02: d7gata_
  • Chain 'B':
    Compound: DNA (5'-d(*cp*ap*gp*tp*gp*ap*tp*ap*gp*ap*gp*ap*c)-3')
  • Chain 'C':
    Compound: DNA (5'-d(*gp*tp*cp*tp*cp*tp*ap*tp*cp*ap*cp*tp*g)-3')
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >7gatA (A:)
    mkngeqngpttctncftqttpvwrrnpegqplcnacglflklhgvvrplslktdvikkrn
    rnsans
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.