PDB entry 7fd1

View 7fd1 on RCSB PDB site
Description: 7-fe ferredoxin from azotobacter vinelandii at ph 8.5, 100 k, 1.35 a
Deposited on 1998-12-11, released 1998-12-16
The last revision prior to the SCOP 1.71 freeze date was dated 1999-12-22, with a file datestamp of 1999-12-21.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.158
AEROSPACI score: 0.74 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.71: d7fd1a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >7fd1A (A:)
  afvvtdncikckytdcvevcpvdcfyegpnflvihpdecidcalcepecpaqaifsedev
  pedmqefiqlnaelaevwpnitekkdplpdaedwdgvkgklqhler