PDB entry 7fab

View 7fab on RCSB PDB site
Description: crystal structure of human immunoglobulin fragment fab new refined at 2.0 angstroms resolution
Class: immune system
Keywords: immunoglobulin, immune system
Deposited on 1991-11-20, released 1994-01-31
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-07-24, with a file datestamp of 2013-07-19.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.169
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: igg1-lambda new fab (heavy chain)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 7FAB (0-216)
    Domains in SCOPe 2.05: d7fabh1, d7fabh2
  • Chain 'L':
    Compound: igg1-lambda new fab (light chain)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 7FAB (0-End)
    Domains in SCOPe 2.05: d7fabl1, d7fabl2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >7fabH (H:)
    avqleqsgpglvrpsqtlsltctvsgtsfddyywtwvrqppgrglewigyvfytgttlld
    pslrgrvtmlvntsknqfslrlssvtaadtavyycarnliaggidvwgqgslvtvssast
    kgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssgly
    slssvvtvpssslgtqtyicnvnhkpsntkvdkkvep
    

    Sequence, based on observed residues (ATOM records): (download)
    >7fabH (H:)
    avqleqsgpglvrpsqtlsltctvsgtsfddyywtwvrqppgrglewigyvfytgttlld
    pslrgrvtmlvntsknqfslrlssvtaadtavyycarnliaggidvwgqgslvtvssast
    kgpsvfplaptaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslssvvtv
    pssslgtqtyicnvnhkpsntkvdkkvep
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >7fabL (L:)
    asvltqppsvsgapgqrvtisctgsssnigaghnvkwyqqlpgtapkllifhnnarfsvs
    ksgtsatlaitglqaedeadyycqsydrslrvfgggtkltvlrqpkaapsvtlfppssee
    lqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassylsltpeq
    wkshksyscqvthegstvektvaptecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >7fabL (L:)
    asvltqppsvsgapgqrvtisctgsssnigaghnvkwyqqlpgtapkllifhnnarfsvs
    ksgtsatlaitglqaedeadyycqsydrslrvfgggtkltvlrqpkaapsvtlfppssee
    lqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassylsltpeq
    wkshksyscqvthegstvektvap