PDB entry 7fab

View 7fab on RCSB PDB site
Description: crystal structure of human immunoglobulin fragment fab new refined at 2.0 angstroms resolution
Class: immunoglobulin
Keywords: immunoglobulin
Deposited on 1991-11-20, released 1994-01-31
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.169
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: igg1-lambda new fab (heavy chain)
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d7fabh1, d7fabh2
  • Chain 'L':
    Compound: igg1-lambda new fab (light chain)
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d7fabl1, d7fabl2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >7fabH (H:)
    avqleqsgpglvrpsqtlsltctvsgtsfddyywtwvrqppgrglewigyvfytgttlld
    pslrgrvtmlvntsknqfslrlssvtaadtavyycarnliaggidvwgqgslvtvssast
    kgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssgly
    slssvvtvpssslgtqtyicnvnhkpsntkvdkkvep
    

    Sequence, based on observed residues (ATOM records): (download)
    >7fabH (H:)
    avqleqsgpglvrpsqtlsltctvsgtsfddyywtwvrqppgrglewigyvfytgttlld
    pslrgrvtmlvntsknqfslrlssvtaadtavyycarnliaggidvwgqgslvtvssast
    kgpsvfplaptaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslssvvtv
    pssslgtqtyicnvnhkpsntkvdkkvep
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >7fabL (L:)
    asvltqppsvsgapgqrvtisctgsssnigaghnvkwyqqlpgtapkllifhnnarfsvs
    ksgtsatlaitglqaedeadyycqsydrslrvfgggtkltvlrqpkaapsvtlfppssee
    lqankatlvclisdfypgavtvawkadgspvkagvetttpskqsnnkyaassylsltpeq
    wkshksyscqvthegstvektvaptecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >7fabL (L:)
    asvltqppsvsgapgqrvtisctgsssnigaghnvkwyqqlpgtapkllifhnnarfsvs
    ksgtsatlaitglqaedeadyycqsydrslrvfgggtkltvlrqpkaapsvtlfppssee
    lqankatlvclisdfypgavtvawkadgspvkagvetttpskqsnnkyaassylsltpeq
    wkshksyscqvthegstvektvap