PDB entry 7est

View 7est on RCSB PDB site
Description: interaction of the peptide cf3-leu-ala-nh-c6h4-cf3(tfla) with porcine pancreatic elastase. x-ray studies at 1.8 angstroms
Class: hydrolase (serine proteinase)
Keywords: hydrolase (serine proteinase)
Deposited on 1990-06-15, released 1991-10-15
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-28.
Experiment type: -
Resolution: 1.8 Å
R-factor: 0.19
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Compound: elastase
    Species: Sus scrofa
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00772 (0-239)
      • conflict (65)
    Domains in SCOP 1.73: d7este_
  • Chain 'I':
    Compound: trifluoroacetyl-*l-*leucyl-*l-*alanyl-p-trifluoromethylphenylanilide
  • Heterogens: SO4, CA, DMF, HOH

PDB Chain Sequences:

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >7estE (E:)
vvggteaqrnswpsqislqyrsgsswahtcggtlirqnwvmtaahcvdreltfrvvvgeh
nlnqnngteqyvgvqkivvhpywntddvaagydiallrlaqsvtlnsyvqlgvlpragti
lannspcyitgwgltrtngqlaqtlqqaylptvdyaicssssywgstvknsmvcaggdgv
rsgcqgdsggplhclvngqyavhgvtsfvsrlgcnvtrkptvftrvsayiswinnviasn

  • Chain 'I':
    No sequence available.