PDB entry 7epb

View 7epb on RCSB PDB site
Description: Cryo-EM structure of LY354740-bound mGlu2 homodimer
Class: membrane protein
Keywords: cryo-EM structure, membrane protein, GPCR
Deposited on 2021-04-26, released 2021-06-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-07-07, with a file datestamp of 2021-07-02.
Experiment type: EM
Resolution: 3.1 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Metabotropic glutamate receptor 2
    Species: Homo sapiens [TaxId:9606]
    Gene: GRM2, GPRC1B, MGLUR2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q14416 (10-816)
      • expression tag (0-9)
      • engineered mutation (592)
      • expression tag (817-850)
  • Chain 'B':
    Compound: Metabotropic glutamate receptor 2
    Species: Homo sapiens [TaxId:9606]
    Gene: GRM2, GPRC1B, MGLUR2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q14416 (10-816)
      • expression tag (0-9)
      • engineered mutation (592)
      • expression tag (817-850)
  • Chain 'C':
    Compound: Anti-RON nanobody
    Species: Lama glama [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 7EPB (0-136)
    Domains in SCOPe 2.08: d7epbc_
  • Chain 'D':
    Compound: Anti-RON nanobody
    Species: Lama glama [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 7EPB (0-136)
    Domains in SCOPe 2.08: d7epbd_
  • Heterogens: 40F

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download) 
    >7epbC (C:)
qvqlvqsggglvqaggslrlscaasvrffsintmgwyrqapgkqrelvaditssgstnya
dsgkgrftisrdnakntvylqmnrlkpedtavyychadykytthntawgqgtqvtvssgr
plevlfqgphhhhhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >7epbC (C:)
qvqlvqsggglvqaggslrlscaasvrffsintmgwyrqapgkqrelvaditssgstnya
dsgkgrftisrdnakntvylqmnrlkpedtavyychadykytthntawgqgtqvtvss

  • Chain 'D':
    Sequence, based on SEQRES records: (download) 
    >7epbD (D:)
qvqlvqsggglvqaggslrlscaasvrffsintmgwyrqapgkqrelvaditssgstnya
dsgkgrftisrdnakntvylqmnrlkpedtavyychadykytthntawgqgtqvtvssgr
plevlfqgphhhhhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >7epbD (D:)
qvqlvqsggglvqaggslrlscaasvrffsintmgwyrqapgkqrelvaditssgstnya
dsgkgrftisrdnakntvylqmnrlkpedtavyychadykytthntawgqgtqvtvss