PDB entry 7ep8

View 7ep8 on RCSB PDB site
Description: Crystal structure of PCNA from Neurospora crassa
Class: DNA binding protein
Keywords: DNA sliding clamp, DNA replication, DNA repair, DNA BINDING PROTEIN
Deposited on 2021-04-26, released 2021-06-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2021-06-30, with a file datestamp of 2021-06-25.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proliferating Cell Nuclear Antigen
    Species: Neurospora crassa OR74A [TaxId:367110]
    Gene: pcn, NCU09239
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d7ep8a1, d7ep8a2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >7ep8A (A:)
mlearleqasilkkvvdaikdlvqdcnfdcndsgialqamdnshvalvsmmlktetfspf
rcdrnialgvnltsltkvlraaqnediltlkaedapdvlnlvfessendriseydlklmd
idqehlgipdteyaatismpssefkrittdlmamsesvnieaskdgvkfscqgdigngsi
tlrqhtnvdkpsenieielsepvsltfslkylvnfckasalsstvkiclsnevpllveyn
isassylrfylapkig