PDB entry 7eow

View 7eow on RCSB PDB site
Description: High-resolution structure of vWF A1 domain in complex with caplacizumab, the first nanobody-based medicine
Class: structural protein
Keywords: vWF, vFW A1, caplacizumab, nanobody, STRUCTURAL PROTEIN
Deposited on 2021-04-23, released 2021-07-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-07-07, with a file datestamp of 2021-07-02.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: von willebrand factor
    Species: Homo sapiens [TaxId:9606]
    Gene: VWF, F8VWF
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04275 (24-231)
      • initiating methionine (0)
      • expression tag (1-23)
  • Chain 'B':
    Compound: caplacizumab
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 7EOW (0-136)
    Domains in SCOPe 2.08: d7eowb1, d7eowb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >7eowB (B:)
mevqlvesggglvqpggslrlscaasgrtfsynpmgwfrqapgkgrelvaaisrtggsty
ypdsvegrftisrdnakrmvylqmnslraedtavyycaaagvraedgrvrtlpseytfwg
qgtqvtvsslehhhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >7eowB (B:)
evqlvesggglvqpggslrlscaasgrtfsynpmgwfrqapgkgrelvaaisrtggstyy
pdsvegrftisrdnakrmvylqmnslraedtavyycaaagvraedgrvrtlpseytfwgq
gtqvtvss