PDB entry 7eoa

View 7eoa on RCSB PDB site
Description: HR-PETase from Bacterium HR29
Class: hydrolase
Keywords: PETase, HYDROLASE
Deposited on 2021-04-21, released 2022-04-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2022-04-27, with a file datestamp of 2022-04-22.
Experiment type: XRAY
Resolution: 1.24 Å
R-factor: N/A
AEROSPACI score: 0.7 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Poly(ethylene terephthalate) hydrolase
    Species: bacterium HR29 [TaxId:2035424]
    Gene: HRbin29_00073
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d7eoaa1, d7eoaa2
  • Heterogens: EOH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >7eoaA (A:)
snpyqrgpnptrsalttdgpfsvatysvsrlsvsgfgggviyyptgttltfggiamspgy
tadasslawlgrrlashgfvvivintnsrldfpdsrasqlsaalnylrtsspsavrarld
anrlavaghsmgggatlriseqiptlkagvpltpwhtdktfntpvpqlivgaeadtvapv
sqhaipfyqnlpsttpkvyveldnathfapnspnaaisvytiswmklwvdndtryrqflc
nvndpalsdfrsnnrhcql