PDB entry 7elg

View 7elg on RCSB PDB site
Description: LC3B modificated with a covalent probe
Class: protein binding
Keywords: Inhibitor, Complex, PROTEIN BINDING
Deposited on 2021-04-10, released 2021-10-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-10-13, with a file datestamp of 2021-10-08.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Microtubule-associated proteins 1A/1B light chain 3B
    Species: Homo sapiens [TaxId:9606]
    Gene: MAP1LC3B, MAP1ALC3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9GZQ8 (5-122)
      • expression tag (0-4)
    Domains in SCOPe 2.08: d7elga1, d7elga2
  • Heterogens: 8Z6, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >7elgA (A:)
gspefpsektfkqrrtfeqrvedvrlireqhptkipviierykgekqlpvldktkflvpd
hvnmselikiirrrlqlnanqaffllvnghsmvsvstpisevyesekdedgflymvyasq
etf

    Sequence, based on observed residues (ATOM records): (download) 
    >7elgA (A:)
spefpsektfkqrrtfeqrvedvrlireqhptkipviierykgekqlpvldktkflvpdh
vnmselikiirrrlqlnanqaffllvnghsmvsvstpisevyesekdedgflymvyasqe
tf