PDB entry 7eb6

View 7eb6 on RCSB PDB site
Description: Crystal structure of GTP-binding protein-like domain of AGAP1
Class: cell adhesion
Keywords: AGAP1, GTP-binding protein-like domain, leukemia, CELL ADHESION
Deposited on 2021-03-09, released 2021-04-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-04-21, with a file datestamp of 2021-04-16.
Experiment type: XRAY
Resolution: 3.01 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: AGAP1, CENTG2, KIAA1099
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UPQ3 (6-End)
      • expression tag (5)
    Domains in SCOPe 2.08: d7eb6a1, d7eb6a2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >7eb6A (A:)
gshmlepelkvgivgnlasgksalvhryltgtyvqeespeggrfkkeivvdgqsylllir
deggppeaqfamwvdavifvfsledeisfqtvyhyysrmanyrntseiplvlvgtqdais
sanprviddararklsndlkrctyyetcatyglnvervfqdvaqkivatrkk

    Sequence, based on observed residues (ATOM records): (download) 
    >7eb6A (A:)
epelkvgivgnlasgksalvhryltgtyvqeespeggrfkkeivvdgqsylllirdeggp
peaqfamwvdavifvfsledeisfqtvyhyysrmanyrntseiplvlvgtqdaissanpr
viddararklsndlkrctyyetcatyglnvervfqdvaqkivatr