PDB entry 7eb1

View 7eb1 on RCSB PDB site
Description: Solution NMR structure of the RRM domain of RNA binding protein RBM3 from homo sapiens
Class: RNA binding protein
Keywords: RNA Recognition Motif (RRM), RNA Binding Motif 3 (RBM3), RNA BINDING PROTEIN
Deposited on 2021-03-08, released 2021-12-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-12-08, with a file datestamp of 2021-12-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RNA-binding protein 3
    Species: Homo sapiens [TaxId:9606]
    Gene: RBM3, RNPL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d7eb1a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >7eb1A (A:)
msseegklfvgglnfntdeqaledhfssfgpisevvvvkdretqrsrgfgfitftnpeha
svamramngesldgrqirvdhagk