PDB entry 7eal

View 7eal on RCSB PDB site
Description: The structure of the A20-Binding Inhibitor of NF-kB 1 in complex with di-ubiquitin
Class: signaling protein
Keywords: M1-ubiquitin, NF-kB, ubiquitin-binding domain, SIGNALING PROTEIN
Deposited on 2021-03-07, released 2021-07-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-07-21, with a file datestamp of 2021-07-16.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin
    Species: Homo sapiens [TaxId:9606]
    Gene: UBC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d7eala1, d7eala2
  • Chain 'B':
    Compound: TNFAIP3-interacting protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: TNIP1, KIAA0113, NAF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15025 (0-108)
      • conflict (101)
  • Chain 'C':
    Compound: TNFAIP3-interacting protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: TNIP1, KIAA0113, NAF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15025 (0-108)
      • conflict (101)
  • Chain 'D':
    Compound: Ubiquitin
    Species: Homo sapiens [TaxId:9606]
    Gene: UBC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d7eald1, d7eald2
  • Chain 'E':
    Compound: TNFAIP3-interacting protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: TNIP1, KIAA0113, NAF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15025 (0-108)
      • conflict (101)
  • Chain 'F':
    Compound: TNFAIP3-interacting protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: TNIP1, KIAA0113, NAF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15025 (0-108)
      • conflict (101)
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >7ealA (A:)
mqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn
iqkestlhlvlrlrggmqifvktltgktitlevepsdtienvkakiqdkegippdqqrli
fagkqledgrtlsdyniqkestlhlvlrlrgg

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >7ealD (D:)
mqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn
iqkestlhlvlrlrggmqifvktltgktitlevepsdtienvkakiqdkegippdqqrli
fagkqledgrtlsdyniqkestlhlvlrlrgg

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.