PDB entry 7ea7

View 7ea7 on RCSB PDB site
Description: crystal structure of NAP1 LIR in complex with GABARAP
Class: protein binding
Keywords: LIR, complex, gabarap, PROTEIN BINDING
Deposited on 2021-03-06, released 2021-12-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-12-22, with a file datestamp of 2021-12-17.
Experiment type: XRAY
Resolution: 2.69 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Gamma-aminobutyric acid receptor-associated protein
    Species: Homo sapiens [TaxId:9606]
    Gene: GABARAP, FLC3B, HT004
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d7ea7a_
  • Chain 'B':
    Compound: Gamma-aminobutyric acid receptor-associated protein
    Species: Homo sapiens [TaxId:9606]
    Gene: GABARAP, FLC3B, HT004
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d7ea7b_
  • Chain 'C':
    Compound: NAP1_LIR motif
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 7EA7 (0-10)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >7ea7A (A:)
mkfvykeehpfekrrsegekirkkypdrvpvivekapkarigdldkkkylvpsdltvgqf
yflirkrihlraedalfffvnnvipptsatmgqlyqehheedfflyiaysdesvygl

    Sequence, based on observed residues (ATOM records): (download) 
    >7ea7A (A:)
mkfvykeehpfekrrsegekirkkypdrvpvivekapkarigdldkkkylvpsdltvgqf
yflirkrihlraedalfffvnnvipptsatmgqlyqehheedfflyiaysdesvyg

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >7ea7B (B:)
mkfvykeehpfekrrsegekirkkypdrvpvivekapkarigdldkkkylvpsdltvgqf
yflirkrihlraedalfffvnnvipptsatmgqlyqehheedfflyiaysdesvygl

    Sequence, based on observed residues (ATOM records): (download) 
    >7ea7B (B:)
mkfvykeehpfekrrsegekirkkypdrvpvivekapkarigdldkkkylvpsdltvgqf
yflirkrihlraedalfffvnnvipptsatmgqlyqehheedfflyiaysdesv

  • Chain 'C':
    No sequence available.