PDB entry 7dz8

View 7dz8 on RCSB PDB site
Description: State transition supercomplex PSI-LHCI-LHCII from the LhcbM1 lacking mutant of Chlamydomonas reinhardtii
Class: photosynthesis
Keywords: Supercomplex, state transition, green alga, Chlamydomonas reinhardtii, PHOTOSYNTHESIS
Deposited on 2021-01-23, released 2021-06-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2021-06-30, with a file datestamp of 2021-06-25.
Experiment type: EM
Resolution: 3.16 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '1':
    Compound: Chlorophyll a-b binding protein, chloroplastic
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d7dz81_
  • Chain '2':
    Compound: Chlorophyll a-b binding protein, chloroplastic
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Database cross-references and differences (RAF-indexed):
  • Chain '3':
    Compound: Chlorophyll a-b binding protein, chloroplastic
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d7dz83_
  • Chain '4':
    Compound: Chlorophyll a-b binding protein, chloroplastic
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d7dz84_
  • Chain '5':
    Compound: Chlorophyll a-b binding protein, chloroplastic
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Database cross-references and differences (RAF-indexed):
  • Chain '6':
    Compound: Chlorophyll a-b binding protein, chloroplastic
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Database cross-references and differences (RAF-indexed):
  • Chain '7':
    Compound: Chlorophyll a-b binding protein, chloroplastic
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d7dz87_
  • Chain '8':
    Compound: Chlorophyll a-b binding protein, chloroplastic
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d7dz88_
  • Chain '9':
    Compound: Chlorophyll a-b binding protein, chloroplastic
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d7dz89_
  • Chain 'A':
    Compound: photosystem I p700 chlorophyll a apoprotein a1
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: photosystem I p700 chlorophyll a apoprotein a2
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d7dz8b_
  • Chain 'C':
    Compound: photosystem I iron-sulfur center
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d7dz8c_
  • Chain 'D':
    Compound: photosystem I reaction center subunit II, chloroplastic
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d7dz8d_
  • Chain 'E':
    Compound: Photosystem I reaction center subunit IV, chloroplastic
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d7dz8e_
  • Chain 'F':
    Compound: photosystem I reaction center subunit III, chloroplastic
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d7dz8f_
  • Chain 'G':
    Compound: photosystem I reaction center subunit v, chloroplastic
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: photosystem I reaction center subunit vi, chloroplastic
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Database cross-references and differences (RAF-indexed):
  • Chain 'I':
    Compound: Photosystem I reaction center subunit VIII
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Database cross-references and differences (RAF-indexed):
  • Chain 'J':
    Compound: Photosystem I reaction center subunit IX
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d7dz8j_
  • Chain 'K':
    Compound: photosystem I reaction center subunit psak, chloroplastic
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Database cross-references and differences (RAF-indexed):
  • Chain 'L':
    Compound: PSI subunit V
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Database cross-references and differences (RAF-indexed):
  • Chain 'O':
    Compound: Photosystem I subunit O
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Database cross-references and differences (RAF-indexed):
  • Chain 'U':
    Compound: Chlorophyll a-b binding protein, chloroplastic
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d7dz8u_
  • Chain 'V':
    Compound: Chlorophyll a-b binding protein, chloroplastic
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d7dz8v_
  • Chain 'W':
    Compound: Chlorophyll a-b binding protein, chloroplastic
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d7dz8w_
  • Chain 'X':
    Compound: Chlorophyll a-b binding protein, chloroplastic
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d7dz8x_
  • Chain 'Y':
    Compound: Chlorophyll a-b binding protein, chloroplastic
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d7dz8y_
  • Chain 'Z':
    Compound: Chlorophyll a-b binding protein, chloroplastic
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d7dz8z_
  • Chain 'a':
    Compound: Chlorophyll a-b binding protein, chloroplastic
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d7dz8a_
  • Heterogens: CHL, CLA, TPO, PQN, LHG, BCR, SF4, LMU, LMG, DGD, LUT, XAT, NEX

PDB Chain Sequences:

  • Chain '1':
    Sequence, based on SEQRES records: (download)
    >7dz81 (1:)
    malsmrtlsartaaprgfsgrrvaavsngsrvtmkagnwlpgsdapawlpddlpgnygfd
    plslgkepaslkrftesevihgrwamlgvagslavellgygnwydaplwavnggkatwfg
    ievpfdlnallafefvamaaaegqrgdaggvvypggafdplgfakdssksgelklkeikn
    grlamvaflgfvaqhaatgkgpiaalgehlanpwganfatngisvpff
    

    Sequence, based on observed residues (ATOM records): (download)
    >7dz81 (1:)
    kagnwlpgsdapawlpddlpgnygfdplslgkepaslkrftesevihgrwamlgvagsla
    vellgygnwydaplwavnggkatwfgievpfdlnallafefvamaaaegqrgdaggvvyp
    ggafdplgfakdssksgelklkeikngrlamvaflgfvaqhaatgkgpiaalgehlanpw
    ganfatngisvpff
    

  • Chain '2':
    No sequence available.

  • Chain '3':
    Sequence, based on SEQRES records: (download)
    >7dz83 (3:)
    mmltksaqaafsgkvarpakanrarlvcraeeksiakvdrskdqlyvgasqsslayldgs
    lpgdfgfdplglldpvnsggfiepkwlqyseviharwamlgaagciapevlgaaglipda
    tnikwfesgvippagsyngywadpytiffveivamqfaelrrlqdfrypgsmgqqyflgl
    eaifkgsgdaaypggpffnlfnlgkteaamkelklkeikngrlamlamlgygaqavmtgk
    gpfqnlvehladpvnnniltnfagrvsgssqpwrphgwwrrryrsvaalalirnrsvc
    

    Sequence, based on observed residues (ATOM records): (download)
    >7dz83 (3:)
    qlyvgasqsslayldgslpgdfgfdplglldpvnsggfiepkwlqyseviharwamlgaa
    gciapevlgaaglipdatnikwfesgvippagsyngywadpytiffveivamqfaelrrl
    qdfrypgsmgqqyflgleaifkgsgdaaypggpffnlfnlgkteaamkelklkeikngrl
    amlamlgygaqavmtgkgpfqnlvehladpvnnniltnfa
    

  • Chain '4':
    Sequence, based on SEQRES records: (download)
    >7dz84 (4:)
    mafvlakssafgvaakpvsrrssvavkasavpenvkearewidawksksggakrdaalps
    wmpgadlpgylngtlpgdfgfdplylgqdpvklkwyaqaelmnarfamlavagilvpell
    snigfswpgagvawydagkfeyfapasslfgvqmllfawveirryqdfvkpgsanqdpif
    tnnklpdgnepgypggifdpfgwskgdikslklkeikngrlamlafagfigqayttgttp
    lknlsthladpwsttvwqndlarl
    

    Sequence, based on observed residues (ATOM records): (download)
    >7dz84 (4:)
    daalpswmpgadlpgylngtlpgdfgfdplylgqdpvklkwyaqaelmnarfamlavagi
    lvpellsnigfswpgagvawydagkfeyfapasslfgvqmllfawveirryqdfvkpgsa
    nqdpiftnnklpdgnepgypggifdpfgwskgdikslklkeikngrlamlafagfigqay
    ttgttplknlsthladpwsttvwqndlarl
    

  • Chain '5':
    No sequence available.

  • Chain '6':
    No sequence available.

  • Chain '7':
    Sequence, based on SEQRES records: (download)
    >7dz87 (7:)
    malsmiaqrragafsarqapravraqaavrpvwfpgnpppahldgslagdygfdplflgq
    epqtlkwyvqaelvhgrfamlgaagiiltsigakvglgfpewydagkvvveknnidfptl
    mviqfylmgwaetkrwydfknpgsqadgsflgfteefkglengypggrffdpmglsrgda
    akyqeykqkevkngrlamiaclgfaaqyaatgkgpldnladhladpnhvnfatngvsipi
    a
    

    Sequence, based on observed residues (ATOM records): (download)
    >7dz87 (7:)
    vrpvwfpgnpppahldgslagdygfdplflgqepqtlkwyvqaelvhgrfamlgaagiil
    tsigakvglgfpewydagkvvveknnidfptlmviqfylmgwaetkrwydfknpgsqadg
    sflgfteefkglengypggrffdpmglsrgdaakyqeykqkevkngrlamiaclgfaaqy
    aatgkgpldnladhladpnhvnfatngvsipia
    

  • Chain '8':
    Sequence, based on SEQRES records: (download)
    >7dz88 (8:)
    maltmkrsgvaarsassrksvvtcvarqswlpgsqipahldtpaaqalagnfgfdplglg
    kdpvalrwyqqaelihcrtamagvagilipglltkagalnvpewydagkvaiensfapwg
    sllavqlflcgfveakrwqdirkpgsqgepgsflgfeaslkgtselgypggpfdplglsk
    eadkwadwklkevkngrlamlaflgfvaqkyatgagpvdnlaahlkdpwhvnyatngvsl
    pfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >7dz88 (8:)
    rqswlpgsqipahldtpaaqalagnfgfdplglgkdpvalrwyqqaelihcrtamagvag
    ilipglltkagalnvpewydagkvaiensfapwgsllavqlflcgfveakrwqdirkpgs
    qgepgsflgfeaslkgtselgypggpfdplglskeadkwadwklkevkngrlamlaflgf
    vaqkyatgagpvdnlaahlkdpwhvnyatngvslpf
    

  • Chain '9':
    Sequence, based on SEQRES records: (download)
    >7dz89 (9:)
    miaaksqvalgrrapvrgqrvvaaasarptwlpglnppahlkgalagdngfdplglgqde
    grlkwyaeaektngrwammavagilgqellgvtpawweagakeydipaqaltpiefivmg
    fleikryqgfkqtgtsgfinsfpfdpagmnspsmatkevkngrlamvafigfcvqalatr
    tqpiegltahladpfgknityylthlpetlgsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >7dz89 (9:)
    rptwlpglnppahlkgalagdngfdplglgqdegrlkwyaeaektngrwammavagilgq
    ellgvtpawweagakeydipaqaltpiefivmgfleikryqgfkqtgtsgfinsfpfdpa
    gmnspsmatkevkngrlamvafigfcvqalatrtqpiegltahladpfgknityylthlp
    etl
    

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >7dz8B (B:)
    matklfpkfsqglaqdpttrriwyglamahdfeshdgmteenlyqkifashfgqlsiifl
    wtsgnlfhvawqgnfeqwvtdpvhirpiahaiwdphfgqpaveaftrggasgpvnistsg
    vyqwwytigmrtnqdlyvgsvflalvsaiflfagwlhlqpnfqpslswfkdaesrlnhhl
    sglfgvsslawtghlvhvaipesrgqhvgwdnflsvlphpqgltpfftgnwaayaqspdt
    ashvfgtaqgsgqailtflggfhpqtqslwltdmahhhlaiavifivaghmyrtnfgigh
    rmqaileahtppsgslgaghkglfdtvnnslhfqlglalasvgtitslvaqhmyslppya
    fqaidfttqaalythhqyiagfimcgafahgaiffirdydpeqnkgnvlarmldhkeali
    shlswvslflgfhtlglyvhndvmqafgtpekqiliepvfaqwiqaahgkalygfdflls
    sktsaafangqslwlpgwldainnnqnslfltigpgdflvhhaialglhtttlilvkgal
    dargsklmpdkkdfgysfpcdgpgrggtcdisaydafylavfwmlntigwvtfywhwkhl
    tlwqgnvaqfdesstylmgwlrdylwlnssqlingynpfgmnslsvwawtflfghliyat
    gfmfliswrgywqelietlvwahektplanlvywkdkpvalsivqarlvglahfsvgyif
    tyaafliastsgrfg
    

    Sequence, based on observed residues (ATOM records): (download)
    >7dz8B (B:)
    atklfpkfsqglaqdpttrriwyglamahdfeshdgmteenlyqkifashfgqlsiiflw
    tsgnlfhvawqgnfeqwvtdpvhirpiahaiwdphfgqpaveaftrggasgpvnistsgv
    yqwwytigmrtnqdlyvgsvflalvsaiflfagwlhlqpnfqpslswfkdaesrlnhhls
    glfgvsslawtghlvhvaipesrgqhvgwdnflsvlphpqgltpfftgnwaayaqspdta
    shvfgtaqgsgqailtflggfhpqtqslwltdmahhhlaiavifivaghmyrtnfgighr
    mqaileahtppsgslgaghkglfdtvnnslhfqlglalasvgtitslvaqhmyslppyaf
    qaidfttqaalythhqyiagfimcgafahgaiffirdydpeqnkgnvlarmldhkealis
    hlswvslflgfhtlglyvhndvmqafgtpekqiliepvfaqwiqaahgkalygfdfllss
    ktsaafangqslwlpgwldainnnqnslfltigpgdflvhhaialglhtttlilvkgald
    argsklmpdkkdfgysfpcdgpgrggtcdisaydafylavfwmlntigwvtfywhwkhlt
    lwqgnvaqfdesstylmgwlrdylwlnssqlingynpfgmnslsvwawtflfghliyatg
    fmfliswrgywqelietlvwahektplanlvywkdkpvalsivqarlvglahfsvgyift
    yaafliastsgrf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >7dz8C (C:)
    mahivkiydtcigctqcvracpldvlemvpwdgckasqmasaprtedcvgckrcetacpt
    dflsvrvylgsestrsmglsy
    

    Sequence, based on observed residues (ATOM records): (download)
    >7dz8C (C:)
    ahivkiydtcigctqcvracpldvlemvpwdgckasqmasaprtedcvgckrcetacptd
    flsvrvylgsestrsmglsy
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >7dz8D (D:)
    mavmmrtqapaatrassrvavaarpaarravvvraeaeaapaaakkaaekpawtvptlnp
    dtpspifggstggllrkaqteefyvitweakkeqifemptggaaimrqgpnllkfgkkeq
    clalttqlrnkfkltpcfyrvfpdgkvqylhpadgvypekvnagrvganqnmrrigqnvn
    pikvkfsgrmmspaei
    

    Sequence, based on observed residues (ATOM records): (download)
    >7dz8D (D:)
    wtvptlnpdtpspifggstggllrkaqteefyvitweakkeqifemptggaaimrqgpnl
    lkfgkkeqclalttqlrnkfkltpcfyrvfpdgkvqylhpadgvypekvnagrvganqnm
    rrigqnvnpikvkfsgrmmspae
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >7dz8E (E:)
    mqalssrvniaakpqraqrlvvraeevkaapkkevgpkrgslvkilrpesywfnqvgkvv
    svdqsgvrypvvvrfenqnyagvttnnyaldevvaak
    

    Sequence, based on observed residues (ATOM records): (download)
    >7dz8E (E:)
    evgpkrgslvkilrpesywfnqvgkvvsvdqsgvrypvvvrfenqnyagvttnnyaldev
    vaa
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >7dz8F (F:)
    maltmrnpavkassrvapssrralrvacqaqknetaskvgtalaasalaaavslsapsaa
    madiagltpcseskayaklekkelktlekrlkqyeadsapavalkatmertkarfanyak
    agllcgndglphliadpglalkyghagevfiptfgflyvagyigyvgrqyliavkgeakp
    tdkeiiidvplatklawqgagwplaavqelqrgtllekeenitvspr
    

    Sequence, based on observed residues (ATOM records): (download)
    >7dz8F (F:)
    diagltpcseskayaklekkelktlekrlkqyeadsapavalkatmertkarfanyakag
    llcgndglphliadpglalkyghagevfiptfgflyvagyigyvgrqyliavkgeakptd
    keiiidvplatklawqgagwplaavqelqrgtllekeenitvspr
    

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >7dz8J (J:)
    mkdfttylstapviatiwftftagllieinryfpdplvfsf
    

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    No sequence available.

  • Chain 'O':
    No sequence available.

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >7dz8U (U:)
    mafalsfsrkalqvsakatgkkgtgktaakqapassgiefygpnrakwlgpysenatpay
    ltgefpgdygwdtaglsadpetfkryreleliharwamlgalgcitpellaksgtqfgea
    vwfkagaqifseggldylgnpslvhaqnivatlavqvilmglvegyrvnggpagegldpl
    ypgesfdplgladdpdtfaelkvkeikngrlamfsmfgffvqaivtgkgpiqnlddhlsn
    ptvnnafafatkftpsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >7dz8U (U:)
    efygpnrakwlgpysenatpayltgefpgdygwdtaglsadpetfkryreleliharwam
    lgalgcitpellaksgtqfgeavwfkagaqifseggldylgnpslvhaqnivatlavqvi
    lmglvegyrvnggpagegldplypgesfdplgladdpdtfaelkvkeikngrlamfsmfg
    ffvqaivtgkgpiqnlddhlsnptvnnafafatkftpsa
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >7dz8V (V:)
    mmlsrtvvnvqakltkkggapkkaapasaqkktirekagwwsnggneklsafygpdrglw
    lgplsgttpayltgefpgdygwdsaglsadpetfkryreleliharwamlgalgcitpel
    lakngtpivepvwfkagaqifaeggldylgnpglvhaqsilatlavqvilmgaiegyrvn
    ggpagegldklhpggqffdplglaedpdafaelkvkeikngrlamfsmfgffvqaivtgk
    gplanldehlaspftsnaftyaqkftpq
    

    Sequence, based on observed residues (ATOM records): (download)
    >7dz8V (V:)
    kktirekagwwsnggneklsafygpdrglwlgplsgttpayltgefpgdygwdsaglsad
    petfkryreleliharwamlgalgcitpellakngtpivepvwfkagaqifaeggldylg
    npglvhaqsilatlavqvilmgaiegyrvnggpagegldklhpggqffdplglaedpdaf
    aelkvkeikngrlamfsmfgffvqaivtgkgplanldehlaspftsnaftyaqkftpq
    

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >7dz8W (W:)
    maaimksavrssvrptvsgrsarvvpraaiewygpdrpkflgpfsegdtpayltgefpgd
    ygwdtaglsadpetfkryreleliharwamlgalgcitpellakngipfgeavwfkagaq
    ifaegglnylgnenlihaqsiiatlafqvvvmglaeayranggplgegldplhpggafdp
    lgladdpdtfaelkvkeikngrlamfsmfgffvqaivtgkgpiqnlddhlanptavnafa
    yatkftpsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >7dz8W (W:)
    iewygpdrpkflgpfsegdtpayltgefpgdygwdtaglsadpetfkryreleliharwa
    mlgalgcitpellakngipfgeavwfkagaqifaegglnylgnenlihaqsiiatlafqv
    vvmglaeayranggplgegldplhpggafdplgladdpdtfaelkvkeikngrlamfsmf
    gffvqaivtgkgpiqnlddhlanptavnafayatkftpsa
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >7dz8X (X:)
    maaimksavrssvrptvsgrsarvvpraaiewygpdrpkflgpfsegdtpayltgefpgd
    ygwdtaglsadpetfkryreleliharwamlgalgcitpellakngipfgeavwfkagaq
    ifaegglnylgnenlihaqsiiatlafqvvvmglaeayranggplgegldplhpggafdp
    lgladdpdtfaelkvkeikngrlamfsmfgffvqaivtgkgpiqnlddhlanptavnafa
    yatkftpsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >7dz8X (X:)
    aiewygpdrpkflgpfsegdtpayltgefpgdygwdtaglsadpetfkryreleliharw
    amlgalgcitpellakngipfgeavwfkagaqifaegglnylgnenlihaqsiiatlafq
    vvvmglaeayranggplgegldplhpggafdplgladdpdtfaelkvkeikngrlamfsm
    fgffvqaivtgkgpiqnlddhlanptavnafayatkftpsa
    

  • Chain 'Y':
    Sequence, based on SEQRES records: (download)
    >7dz8Y (Y:)
    mafalsfsrkalqvsakatgkkgtgktaakqapassgiefygpnrakwlgpysenatpay
    ltgefpgdygwdtaglsadpetfkryreleliharwamlgalgcitpellaksgtqfgea
    vwfkagaqifseggldylgnpslvhaqnivatlavqvilmglvegyrvnggpagegldpl
    ypgesfdplgladdpdtfaelkvkeikngrlamfsmfgffvqaivtgkgpiqnlddhlsn
    ptvnnafafatkftpsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >7dz8Y (Y:)
    iefygpnrakwlgpysenatpayltgefpgdygwdtaglsadpetfkryreleliharwa
    mlgalgcitpellaksgtqfgeavwfkagaqifseggldylgnpslvhaqnivatlavqv
    ilmglvegyrvnggpagegldplypgesfdplgladdpdtfaelkvkeikngrlamfsmf
    gffvqaivtgkgpiqnlddhlsnptvnnafafatkftps
    

  • Chain 'Z':
    Sequence, based on SEQRES records: (download)
    >7dz8Z (Z:)
    mafalsfsrkalqvsakatgkkgtgktaakqapassgiefygpnrakwlgpysenatpay
    ltgefpgdygwdtaglsadpetfkryreleliharwamlgalgcitpellaksgtqfgea
    vwfkagaqifseggldylgnpslvhaqnivatlavqvilmglvegyrvnggpagegldpl
    ypgesfdplgladdpdtfaelkvkeikngrlamfsmfgffvqaivtgkgpiqnlddhlsn
    ptvnnafafatkftpsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >7dz8Z (Z:)
    giefygpnrakwlgpysenatpayltgefpgdygwdtaglsadpetfkryreleliharw
    amlgalgcitpellaksgtqfgeavwfkagaqifseggldylgnpslvhaqnivatlavq
    vilmglvegyrvnggpagegldplypgesfdplgladdpdtfaelkvkeikngrlamfsm
    fgffvqaivtgkgpiqnlddhlsnptvnnafafatkftpsa
    

  • Chain 'a':
    Sequence, based on SEQRES records: (download)
    >7dz8a (a:)
    malsmrtlsartaaprgfsgrrvaavsngsrvtmkagnwlpgsdapawlpddlpgnygfd
    plslgkepaslkrftesevihgrwamlgvagslavellgygnwydaplwavnggkatwfg
    ievpfdlnallafefvamaaaegqrgdaggvvypggafdplgfakdssksgelklkeikn
    grlamvaflgfvaqhaatgkgpiaalgehlanpwganfatngisvpff
    

    Sequence, based on observed residues (ATOM records): (download)
    >7dz8a (a:)
    kagnwlpgsdapawlpddlpgnygfdplslgkepaslkrftesevihgrwamlgvagsla
    vellgygnwydaplwavnggkatwfgievpfdlnallafefvamaaaegqrgdaggvvyp
    ggafdplgfakdssksgelklkeikngrlamvaflgfvaqhaatgkgpiaalgehlanpw
    ganfatngisvpff