PDB entry 7dma

View 7dma on RCSB PDB site
Description: crystal structure of flim middle domain (46-231) with r49p substitution from vibro alginolyticus
Deposited on 2020-12-03, released 2021-07-07
The last revision was dated 2021-12-22, with a file datestamp of 2021-12-17.
Experiment type: XRAY
Resolution: 1.44 Å
R-factor: N/A
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Flagellar motor switch protein fliM
    Species: Vibrio alginolyticus [TaxId:663]
    Gene: FliM
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A6F8W0A1 (4-102)
      • expression tag (0-3)
      • engineered mutation (11)
  • Chain 'B':
    Compound: Flagellar motor switch protein fliM
    Species: Vibrio alginolyticus [TaxId:663]
    Gene: FliM
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >7dmaA (A:)
    gshmqdrivrgpmptlelinerfarhmrislfnmlrktaevsingvqmmkfgeyqntlyv
    ptslnmvrfrplkgtalitmearlvfilvenffggdgrfhaki
    

    Sequence, based on observed residues (ATOM records):
    >7dmaA (A:)
    vrgpmptlelinerfarhmrislfnmlrktaevsingvqmmkfgeyqntlyvptslnmvr
    frplkgtalitmearlvfilvenffggdgrfha
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >7dmaB (B:)
    egreftpterriiqlllkivfedykeawspvmgvefeyldsevnpsmanivsptevivvs
    sfhievdggggdfhvvmpysmvepirellda