PDB entry 7dl8

View 7dl8 on RCSB PDB site
Description: Crystal structure of ALBA1 from Trypanosoma brucei
Class: RNA binding protein
Keywords: ALBA domain, RNA binding, RNA BINDING PROTEIN
Deposited on 2020-11-26, released 2021-06-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-07-07, with a file datestamp of 2021-07-02.
Experiment type: XRAY
Resolution: 2.46 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: ALBA-Domain Protein
  Species: Trypanosoma brucei [TaxId:5691]
  Gene: ALBA1
  Database cross-references and differences (RAF-indexed):
  • Uniprot A0A3L6KSX9 (1-125)
    • expression tag (0)
    • expression tag (126-133)
• Chain 'B':
  Compound: ALBA-Domain Protein
  Species: Trypanosoma brucei [TaxId:5691]
  Gene: ALBA1
  Database cross-references and differences (RAF-indexed):
  • Uniprot A0A3L6KSX9 (1-125)
    • expression tag (0)
    • expression tag (126-133)
• Chain 'C':
  Compound: ALBA-Domain Protein
  Species: Trypanosoma brucei [TaxId:5691]
  Gene: ALBA1
  Database cross-references and differences (RAF-indexed):
  • Uniprot A0A3L6KSX9 (1-125)
    • expression tag (0)
    • expression tag (126-133)
  Domains in SCOPe 2.08: d7dl8c_
• Chain 'D':
  Compound: ALBA-Domain Protein
  Species: Trypanosoma brucei [TaxId:5691]
  Gene: ALBA1
  Database cross-references and differences (RAF-indexed):
  • Uniprot A0A3L6KSX9 (1-125)
    • expression tag (0)
    • expression tag (126-133)
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  Sequence, based on SEQRES records: (download)
  

  >7dl8C (C:)
  mmttgksdrprnsvrvgyrgtkflfvditkhllhdgekevyvsalggaineavsvvemlk
  dqqmvvvkkittsrqvseepddgpvdkieivvtkadgfdakyeeqqkareakrlekekne
  kekatalehhhhhh
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >7dl8C (C:)
  prnsvrvgyrgtkflfvditkhllhdgekevyvsalggaineavsvvemlkdqqmvvvkk
  ittsrqvgpvdkieivvtkadgfdakyeeqqkareakr
  

  
  
• Chain 'D':
  No sequence available.