PDB entry 7dkz

View 7dkz on RCSB PDB site
Description: Structure of plant photosystem I-light harvesting complex I supercomplex
Class: photosynthesis
Keywords: PSI-LHCI high plants, PHOTOSYNTHESIS
Deposited on 2020-11-25, released 2021-03-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2021-03-31, with a file datestamp of 2021-03-26.
Experiment type: XRAY
Resolution: 2.39 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '1':
    Compound: Lhca1
    Species: Pisum sativum [TaxId:3888]
    Database cross-references and differences (RAF-indexed):
    • PDB 7DKZ (0-194)
    Domains in SCOPe 2.07: d7dkz1_
  • Chain '2':
    Compound: Chlorophyll a-b binding protein, chloroplastic
    Species: PISUM SATIVUM [TaxId:3888]
    Gene: lhaB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d7dkz2_
  • Chain '3':
    Compound: Chlorophyll a-b binding protein 3, chloroplastic
    Species: PISUM SATIVUM [TaxId:3888]
    Gene: lhca3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d7dkz3_
  • Chain '4':
    Compound: chlorophyll a-b binding protein p4, chloroplastic
    Species: PISUM SATIVUM [TaxId:3888]
    Gene: lhcA-P4
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9SQL2
      • conflict (37)
      • conflict (76)
      • conflict (97)
    Domains in SCOPe 2.07: d7dkz4_
  • Chain 'A':
    Compound: photosystem I p700 chlorophyll a apoprotein a1
    Species: PISUM SATIVUM [TaxId:3888]
    Gene: psaA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d7dkza_
  • Chain 'B':
    Compound: photosystem I p700 chlorophyll a apoprotein a2
    Species: PISUM SATIVUM [TaxId:3888]
    Gene: psaB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d7dkzb_
  • Chain 'C':
    Compound: photosystem I iron-sulfur center
    Species: PISUM SATIVUM [TaxId:3888]
    Gene: psaC, frxA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d7dkzc_
  • Chain 'D':
    Compound: PsaD
    Species: Pisum sativum [TaxId:3888]
    Database cross-references and differences (RAF-indexed):
    • PDB 7DKZ (Start-142)
    Domains in SCOPe 2.07: d7dkzd_
  • Chain 'E':
    Compound: PsaE
    Species: PISUM SATIVUM [TaxId:3888]
    Database cross-references and differences (RAF-indexed):
    • Uniprot E1C9K6 (2-60)
      • conflict (15)
      • expression tag (61-64)
    Domains in SCOPe 2.07: d7dkze1, d7dkze2
  • Chain 'F':
    Compound: psi-f
    Species: PISUM SATIVUM [TaxId:3888]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0M3KL12 (0-End)
      • conflict (2)
      • conflict (9)
      • conflict (30)
      • conflict (33)
      • conflict (56)
      • conflict (110)
      • conflict (126)
    Domains in SCOPe 2.07: d7dkzf_
  • Chain 'G':
    Compound: PsaG
    Species: Pisum sativum [TaxId:3888]
    Database cross-references and differences (RAF-indexed):
    • PDB 7DKZ (0-End)
  • Chain 'H':
    Compound: PsaH
    Species: Pisum sativum [TaxId:3888]
    Database cross-references and differences (RAF-indexed):
    • PDB 7DKZ (0-87)
  • Chain 'I':
    Compound: Photosystem I reaction center subunit VIII
    Species: PISUM SATIVUM [TaxId:3888]
    Gene: PSAI
    Database cross-references and differences (RAF-indexed):
  • Chain 'J':
    Compound: Photosystem I reaction center subunit IX
    Species: PISUM SATIVUM [TaxId:3888]
    Gene: psaJ
    Database cross-references and differences (RAF-indexed):
    • Uniprot D5MAL3 (0-End)
      • conflict (31)
    Domains in SCOPe 2.07: d7dkzj_
  • Chain 'K':
    Compound: psi-k
    Species: PISUM SATIVUM [TaxId:3888]
    Database cross-references and differences (RAF-indexed):
    • Uniprot E1C9L3 (0-79)
      • conflict (39)
  • Chain 'L':
    Compound: PsaL
    Species: Pisum sativum [TaxId:3888]
    Database cross-references and differences (RAF-indexed):
    • PDB 7DKZ
  • Heterogens: DGD, LHG, LMG, CLA, CHL, LUT, XAT, BCR, LMT, HTG, PQN, SF4, HOH

PDB Chain Sequences:

  • Chain '1':
    Sequence; same for both SEQRES and ATOM records: (download)
    >7dkz1 (1:)
    adwmpgqprpsyldgsapgdfgfdplrlgevpenlerfkeselihcrwamlavpgilvpe
    alglgnwvkaqewaalpggqatylgnpvpwgtlptilvieflsiafvehqrsmekdpekk
    kypggafdplgyskdpkkfheykikevkngrlallafvgicvqqsaypgtgplenlathl
    adpwhntignvlipa
    

  • Chain '2':
    Sequence, based on SEQRES records: (download)
    >7dkz2 (2:)
    masacassaiaavaistpssqkngspsgtskaflgrklkvnsstaspsrvrststvctva
    epdrplwfpgstpppwldgslpgdfgfdplglgsdpeslrwnvqaelvhsrwamlgaagi
    fipefltklgilntpswytageqeyftdtttlfivelvfigwaegrrwadilnpgcvntd
    pifpnnkltgtdvgypgglwfdplgwgsaspqklkelrtkeikngrlamlavmgawfqhi
    ytgtgpidnlfahladpghatifaaftpk
    

    Sequence, based on observed residues (ATOM records): (download)
    >7dkz2 (2:)
    pdrplwfpgstpppwldgslpgdfgfdplglgsdpeslrwnvqaelvhsrwamlgaagif
    ipefltklgilntpswytageqeyftdtttlfivelvfigwaegrrwadilnpgcvntdp
    ifpnnkltgtdvgypgglwfdplgwgsaspqklkelrtkeikngrlamlavmgawfqhiy
    tgtgpidnlfahladpghatifaa
    

  • Chain '3':
    Sequence, based on SEQRES records: (download)
    >7dkz3 (3:)
    matqalvssssltfaaeavrqsfrarslpssvgcsrkglvraaatppvkqggvdrplwfa
    skqslsyldgslpgdygfdplglsdpegtggfieprwlaygevingrfamlgavgaiape
    ylgkvglipqetalawfqtgvippagtynywadnytlfvlemalmgfaehrrfqdwakpg
    smgkqyflglekgfggsgnpaypggpffnplgfgkdekslkelklkevkngrlamlailg
    yfiqglvtgvgpyqnlldhvadpvnnnvltslkfh
    

    Sequence, based on observed residues (ATOM records): (download)
    >7dkz3 (3:)
    plwfaskqslsyldgslpgdygfdplglsdpegtggfieprwlaygevingrfamlgavg
    aiapeylgkvglipqetalawfqtgvippagtynywadnytlfvlemalmgfaehrrfqd
    wakpgsmgkqyflglekgfggsgnpaypggpffnplgfgkdekslkelklkevkngrlam
    lailgyfiqglvtgvgpyqnlldhvadpvnnnvlts
    

  • Chain '4':
    Sequence, based on SEQRES records: (download)
    >7dkz4 (4:)
    kkgewlpglaspgyltgslpgdngfdplglaedpenlkwfvqaelvngrwamlgvagmll
    pevftsigiinvpkwydagkeeyfassstlfviefilfhyveirrwqdiknpgsvnqdpi
    fkqyslpagevgypggifnplnfaptleakekeiangrlamlaflgfiiqhnvtgkgpfd
    nllqhisdpwhntivqtl
    

    Sequence, based on observed residues (ATOM records): (download)
    >7dkz4 (4:)
    kgewlpglaspgyltgslpgdngfdplglaedpenlkwfvqaelvngrwamlgvagmllp
    evftsigiinvpkwydagkeeyfassstlfviefilfhyveirrwqdiknpgsvnqdpif
    kqyslpagevgypggifnplnfaptleakekeiangrlamlaflgfiiqhnvtgkgpfdn
    llqhisdpwhntivq
    

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >7dkzA (A:)
    miirspepkvqiladpevkilvdrdpiktsfeqwakpghfsrtiakgpdtttwiwnlhad
    ahdfdshtsdleeisrkvfsahfgqlsiiflwlsgmyfhgarfsnyeawlndpthirpsa
    qvvwpivgqeilngdvgggfrgiqitsgffqiwrasgitselqlyctaigalvfaalmlf
    agwfhyhkaapklvwfqdvesmlnhhlagllglgslswaghqihvslpinqflnagvdpk
    eiplphefilnrdllaqlypsfaegatpfftlnwskyadfltfrggldpltgglwltdia
    hhhlaiailfliaghmyrtnwgighgikdileahkgpftgqghkglyeilttswhaqlsi
    nlamlgsltiivahhmyamppypylatdygtqlslfthhmwiggflivgaaahaaifmvr
    dydpttryndlldrvlrhrdaiishlnwvciflgfhsfglyihndtmsalgrpqdmfsdt
    aiqlqpvfaqwiqnthalapgttapgattstsltwgggdlvsvggkvallpiplgtadfl
    vhhihaftihvtvlillkgvlfarssrlipdkanlgfrfpcdgpgrggtcqvsawdhvfl
    glfwmynaisvvifhfswkmqsdvwgsindqgvvthitggnfaqssitingwlrdflwaq
    asqviqsygsslsayglfflgahfvwafslmflfsgrgywqeliesivwahnklkvapat
    qpralsivqgravgvthyllggiattwafflariiavg
    

    Sequence, based on observed residues (ATOM records): (download)
    >7dkzA (A:)
    evkilvdrdpiktsfeqwakpghfsrtiakgpdtttwiwnlhadahdfdshtsdleeisr
    kvfsahfgqlsiiflwlsgmyfhgarfsnyeawlndpthirpsaqvvwpivgqeilngdv
    gggfrgiqitsgffqiwrasgitselqlyctaigalvfaalmlfagwfhyhkaapklvwf
    qdvesmlnhhlagllglgslswaghqihvslpinqflnagvdpkeiplphefilnrdlla
    qlypsfaegatpfftlnwskyadfltfrggldpltgglwltdiahhhlaiailfliaghm
    yrtnwgighgikdileahkgpftgqghkglyeilttswhaqlsinlamlgsltiivahhm
    yamppypylatdygtqlslfthhmwiggflivgaaahaaifmvrdydpttryndlldrvl
    rhrdaiishlnwvciflgfhsfglyihndtmsalgrpqdmfsdtaiqlqpvfaqwiqnth
    alapgttapgattstsltwgggdlvsvggkvallpiplgtadflvhhihaftihvtvlil
    lkgvlfarssrlipdkanlgfrfpcdgpgrggtcqvsawdhvflglfwmynaisvvifhf
    swkmqsdvwgsindqgvvthitggnfaqssitingwlrdflwaqasqviqsygsslsayg
    lfflgahfvwafslmflfsgrgywqeliesivwahnklkvapatqpralsivqgravgvt
    hyllggiattwafflariiavg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >7dkzB (B:)
    malrfprfsqglaqdpttrriwfgiatahdfeshdditegrlyqnifashfgqlaiiflw
    tsgnlfhvawqgnfeawvqdplhvrpiahaiwdphfgqpaveaftrggalgpvniaysgv
    yqwwytiglrtnedlytgaifllflsfisllagwlhlqpkwkpsvswfknaesrlnhhls
    glfgvsslawaghlvhvaipgsrgeyvrwnnflsvlphpqglgplftgqwnlyaqnpdss
    nhlfstsqgagtailtllggfhpqtqslwltdmahhhlaiailfligghmyrtnfgighs
    ikyileahippggrlgrghkglydtinnsihfqlglalaslgvitslvaqhmyslpayaf
    iaqdfttqaalythhqyiagfimtgafahgaiffirdynpeqnadnvlarmlehkeaiis
    hlswaslflgfhtlglyvhndvmlafgtpekqiliepifaqwiqsahgktsygfdvllss
    tnspalnagrsiwlpgwlnainensnslfltigpgdflvhhaialglhtttlilvkgald
    argsklmpdkkdfgysfpcdgpgrggtcdisawdafylavfwmlntigwvtfywhwkhit
    lwqgnvsqfnesstylmgwlrdylwlnssqlingynpfgmnslsvwawmflfghlvwatg
    fmfliswrgywqelietlawahertplanlirwrdkpvalsivqarlvglvhfsvgyift
    yaafliastsgkfg
    

    Sequence, based on observed residues (ATOM records): (download)
    >7dkzB (B:)
    alrfprfsqglaqdpttrriwfgiatahdfeshdditegrlyqnifashfgqlaiiflwt
    sgnlfhvawqgnfeawvqdplhvrpiahaiwdphfgqpaveaftrggalgpvniaysgvy
    qwwytiglrtnedlytgaifllflsfisllagwlhlqpkwkpsvswfknaesrlnhhlsg
    lfgvsslawaghlvhvaipgsrgeyvrwnnflsvlphpqglgplftgqwnlyaqnpdssn
    hlfstsqgagtailtllggfhpqtqslwltdmahhhlaiailfligghmyrtnfgighsi
    kyileahippggrlgrghkglydtinnsihfqlglalaslgvitslvaqhmyslpayafi
    aqdfttqaalythhqyiagfimtgafahgaiffirdynpeqnadnvlarmlehkeaiish
    lswaslflgfhtlglyvhndvmlafgtpekqiliepifaqwiqsahgktsygfdvllsst
    nspalnagrsiwlpgwlnainensnslfltigpgdflvhhaialglhtttlilvkgalda
    rgsklmpdkkdfgysfpcdgpgrggtcdisawdafylavfwmlntigwvtfywhwkhitl
    wqgnvsqfnesstylmgwlrdylwlnssqlingynpfgmnslsvwawmflfghlvwatgf
    mfliswrgywqelietlawahertplanlirwrdkpvalsivqarlvglvhfsvgyifty
    aafliastsgkfg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >7dkzC (C:)
    mshsvkiydtcigctqcvracptdvlemipwggckakqiasaprtedcvgckrcesacpt
    dflsvrvylwhettrsmglay
    

    Sequence, based on observed residues (ATOM records): (download)
    >7dkzC (C:)
    shsvkiydtcigctqcvracptdvlemipwggckakqiasaprtedcvgckrcesacptd
    flsvrvylwhettrsmglay
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >7dkzD (D:)
    gftppeldpntpspifggstggllrkaqveefyvitwespkeqifemptggaaimregpn
    llklarkeqclalgtrlrskykikyqfyrvfpsgevqylhpkdgvypekvnpgrqgvgvn
    frsigknvspievkftgkqpydl
    

    Sequence, based on observed residues (ATOM records): (download)
    >7dkzD (D:)
    ppeldpntpspifggstggllrkaqveefyvitwespkeqifemptggaaimregpnllk
    larkeqclalgtrlrskykikyqfyrvfpsgevqylhpkdgvypekvnpgrqgvgvnfrs
    igknvspievkftgkqpydl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >7dkzE (E:)
    ppigpkrgakvkilrqesywykgtgsvvavdqdpntrypvvvrfnkvnyanvstnnyald
    eveevk
    

    Sequence, based on observed residues (ATOM records): (download)
    >7dkzE (E:)
    igpkrgakvkilrqesywykgtgsvvavdqdpntrypvvvrfnkvnyanvstnnyaldev
    eev
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >7dkzF (F:)
    diagltpckdskqfakrekqsikklesslklyapdsapalainatiektkrrfdnygkqg
    llcgadglphlivsgdqrhwgefitpgilflyiagwigwvgrsyliairddkkptqkeii
    idvplatrlvfrgfswpiaayrellngelvakdv
    

    Sequence, based on observed residues (ATOM records): (download)
    >7dkzF (F:)
    diagltpckdskqfakrekqsikklesslklyapdsapalainatiektkrrfdnygkqg
    llcgadglphlivsgdqrhwgefitpgilflyiagwigwvgrsyliairddkkptqkeii
    idvplatrlvfrgfswpiaayrellngelvak
    

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >7dkzJ (J:)
    mrdlktylsvapvastlwfaalagllieinrffpdaltfpff
    

    Sequence, based on observed residues (ATOM records): (download)
    >7dkzJ (J:)
    mrdlktylsvapvastlwfaalagllieinrffpdaltf
    

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    No sequence available.