PDB entry 7dkr

View 7dkr on RCSB PDB site
Description: Crystal structure of native E. coli Grx2 at 2.38 A
Class: oxidoreductase
Keywords: Oxidoreductase, E. coli Grx2, Native
Deposited on 2020-11-25, released 2021-12-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-12-08, with a file datestamp of 2021-12-03.
Experiment type: XRAY
Resolution: 2.38 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutaredoxin
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d7dkra1, d7dkra2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >7dkrA (A:)
mklyiydhcpyclkarmifglknipvelhvllnddaetptrmvgqkqvpilqkddsrymp
esmdivhyvdkldgkplltgkrspaieewlrkvngyanklllprfaksafdefstpaark
yfvdkkeasagnfadllahsdgliknisddlraldklivkpnavngelseddiqlfpllr
nltlvaginwpsrvadyrdnmakqtqinllssmai