PDB entry 7djc

View 7djc on RCSB PDB site
Description: Crystal structure of the G26C/Q250A mutant of LeuT
Class: transport protein
Keywords: Neurotransmitter transporter, NSS, SLC6, TRANSPORT PROTEIN
Deposited on 2020-11-20, released 2021-04-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-07-21, with a file datestamp of 2021-07-16.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Na(+):neurotransmitter symporter (Snf family)
    Species: Aquifex aeolicus [TaxId:63363]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O67854 (0-512)
      • engineered mutation (25)
      • engineered mutation (249)
    Domains in SCOPe 2.08: d7djca_
  • Heterogens: NA, LEU, BOG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >7djcA (A:)
    mevkrehwatrlglilamagnavglcnflrfpvqaaengggafmipyiiafllvgiplmw
    iewamgryggaqghgttpaifyllwrnrfakilgvfglwiplvvaiyyvyieswtlgfai
    kflvglvpepppnatdpdsilrpfkeflysyigvpkgdepilkpslfayivflitmfinv
    silirgiskgierfakiamptlfilavflvirvflletpngtaadglnflwtpdfeklkd
    pgvwiaavgaifftlslgfgaiityasyvrkdqdivlsgltaatlnekaevilggsisip
    aavaffgvanavaiakagafnlgfitlpaifsqtaggtflgflwffllffagltssiaim
    qpmiafledelklsrkhavlwtaaivffsahlvmflnksldemdfwagtigvvffgltel
    iiffwifgadkaweeinrggiikvpriyyyvmryitpaflavllvvwareyipkimeeth
    wtvwitrfyiiglflfltflvflaerrrnhesa
    

    Sequence, based on observed residues (ATOM records): (download)
    >7djcA (A:)
    rehwatrlglilamagnavglcnflrfpvqaaengggafmipyiiafllvgiplmwiewa
    mgryggaqghgttpaifyllwrnrfakilgvfglwiplvvaiyyvyieswtlgfaikflv
    glvpeppppdsilrpfkeflysyigvpkgdepilkpslfayivflitmfinvsilirgis
    kgierfakiamptlfilavflvirvflletpngtaadglnflwtpdpgvwiaavgaifft
    lslgfgaiityasyvrkdqdivlsgltaatlnekaevilggsisipaavaffgvanavai
    akagafnlgfitlpaifsqtaggtflgflwffllffagltssiaimqpmiafledelkls
    rkhavlwtaaivffsahlvmflnksldemdfwagtigvvffglteliiffwifgadkawe
    einrggiikvpriyyyvmryitpaflavllvvwareyiphwtvwitrfyiiglflfltfl
    vflaerrr