PDB entry 7din

View 7din on RCSB PDB site
Description: Structure of PfGrx1 with cobalt
Class: oxidoreductase
Keywords: redox enzyme, trx fold, glutathione, co-sad, oxidoreductase
Deposited on 2020-11-19, released 2021-11-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-11-24, with a file datestamp of 2021-11-19.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutaredoxin
    Species: Plasmodium falciparum (isolate 3D7) [TaxId:36329]
    Gene: PF3D7_0306300
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d7dina_
  • Heterogens: CO, MPO, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >7dinA (A:)
magtseavkkwvnkiieeniiavfaktecpycikaisilkgynlnshmhvenieknpdma
niqaylkeltgkssvprifinkdvvggcddlvkendegklkerlqklglvn

    Sequence, based on observed residues (ATOM records): (download) 
    >7dinA (A:)
eavkkwvnkiieeniiavfaktecpycikaisilkgynlnshmhvenieknpdmaniqay
lkeltgkssvprifinkdvvggcddlvkendegklkerlqklglvn