PDB entry 7dht

View 7dht on RCSB PDB site
Description: Solution structure of ATG8f of Arabidopsis thaliana
Class: endocytosis
Keywords: Autophagy, NMR1, SH3P2, ENDOCYTOSIS
Deposited on 2020-11-17, released 2021-12-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-12-01, with a file datestamp of 2021-11-26.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Autophagy-related protein 8f
  Species: Arabidopsis thaliana [TaxId:3702]
  Gene: ATG8F, APG8F
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8VYK7 (0-120)
  Domains in SCOPe 2.08: d7dhta_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >7dhtA (A:)
  makssfkqehdlekrraeaarirekypdripvivekaeksdiptidkkkylvpadltvgq
  fvyvirkriklsaekaififvdnvlppagalmssvyeekkdddgflyvtysgentfgfgs
  p