PDB entry 7dcj

View 7dcj on RCSB PDB site
Description: Crystal structure of HSF1 DNA-binding domain in complex with 2-site HSE DNA in the head-to-head orientation
Class: DNA binding protein/DNA
Keywords: DNA binding protein-DNA complex
Deposited on 2020-10-26, released 2021-07-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-07-14, with a file datestamp of 2021-07-09.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Heat shock factor protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: HSF1, HSTF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q00613 (7-112)
      • expression tag (0-6)
    Domains in SCOPe 2.08: d7dcja_
  • Chain 'B':
    Compound: Heat shock factor protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: HSF1, HSTF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q00613 (7-112)
      • expression tag (0-6)
    Domains in SCOPe 2.08: d7dcjb1, d7dcjb2
  • Chain 'C':
    Compound: DNA (5'-d(*gp*cp*cp*gp*ap*ap*tp*ap*tp*tp*cp*gp*g)-3')
    Species: Homo sapiens [TaxId:9606]
  • Chain 'D':
    Compound: DNA (5'-d(*gp*cp*cp*gp*ap*ap*tp*ap*tp*tp*cp*gp*g)-3')
    Species: Homo sapiens [TaxId:9606]
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >7dcjA (A:)
ghhhhhhvpafltklwtlvsdpdtdalicwspsgnsfhvfdqgqfakevlpkyfkhnnma
sfvrqlnmygfrkvvhieqgglvkperddtefqhpcflrgqeqllenikrkvt

    Sequence, based on observed residues (ATOM records): (download) 
    >7dcjA (A:)
vpafltklwtlvsdpdtdalicwspsgnsfhvfdqgqfakevlpkyfkhnnmasfvrqln
mygfrkvverddtefqhpcflrgqeqllenikrk

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >7dcjB (B:)
ghhhhhhvpafltklwtlvsdpdtdalicwspsgnsfhvfdqgqfakevlpkyfkhnnma
sfvrqlnmygfrkvvhieqgglvkperddtefqhpcflrgqeqllenikrkvt

    Sequence, based on observed residues (ATOM records): (download) 
    >7dcjB (B:)
ghhhhhhvpafltklwtlvsdpdtdalicwspsgnsfhvfdqgqfakevlpkyfkhnnma
sfvrqlnmygfrkvvhieqgglvkpdtefqhpcflrgqeqllenikrkvt

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.