PDB entry 7da8

View 7da8 on RCSB PDB site
Description: X-ray structure of a GB1:T2Q/D46K mutant
Class: protein binding
Keywords: GB1, T2Q mutant, D46K mutant, X-ray crystal structure, PLANT PROTEIN, PROTEIN BINDING
Deposited on 2020-10-15, released 2021-10-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-10-27, with a file datestamp of 2021-10-22.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Immunoglobulin G-binding protein G
    Species: Streptococcus sp. group G [TaxId:1320]
    Gene: spg
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19909 (1-55)
      • initiating methionine (0)
      • engineered mutation (1)
      • engineered mutation (45)
      • expression tag (56-61)
    Domains in SCOPe 2.08: d7da8a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >7da8A (A:)
    mqyklilngktlkgettteavdaataekvfkqyandngvdgewtykdatktftvtehhhh
    hh
    

    Sequence, based on observed residues (ATOM records): (download)
    >7da8A (A:)
    mqyklilngktlkgettteavdaataekvfkqyandngvdgewtykdatktftvte