PDB entry 7d9l

View 7d9l on RCSB PDB site
Description: Crystal structure of E. coli Grx2: Enzyme inhibited state in complex with Zinc and glutathione sulfinic acid
Class: oxidoreductase
Keywords: E. coli, GRX2, Zinc, Glutathione sulfinic acid, Oxidoreductase, Enzyme inhibition
Deposited on 2020-10-13, released 2021-10-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-10-27, with a file datestamp of 2021-10-22.
Experiment type: XRAY
Resolution: 1.61 Å
R-factor: N/A
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutaredoxin
    Species: Escherichia coli [TaxId:562]
    Gene: grxB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d7d9la1, d7d9la2
  • Heterogens: CL, GSF, OXY, ZN, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >7d9lA (A:)
mklyiydhcpyclkarmifglknipvelhvllnddaetptrmvgqkqvpilqkddsrymp
esmdivhyvdkldgkplltgkrspaieewlrkvngyanklllprfaksafdefstpaark
yfvdkkeasagnfadllahsdgliknisddlraldklivkpnavngelseddiqlfpllr
nltlvaginwpsrvadyrdnmakqtqinllssmai