PDB entry 7d83

View 7d83 on RCSB PDB site
Description: Crystal structure of HIV-1 integrase catalytic core domain in complex with 2-(tert-butoxy)-2-(2-(3-cyclohexylureido)-3,6-dimethyl-5-(5-methylchroman-6-yl)pyridin-4-yl)acetic acid
Class: viral protein
Keywords: HIV-1 Integrase, VIRAL PROTEIN
Deposited on 2020-10-07, released 2021-01-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2021-01-13, with a file datestamp of 2021-01-08.
Experiment type: XRAY
Resolution: 2.43 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: integrase
    Species: Human immunodeficiency virus type 1 group M subtype B (isolate NY5) [TaxId:11698]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12497
      • engineered mutation (138)
    Domains in SCOPe 2.07: d7d83a_
  • Heterogens: SO4, GZ9, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >7d83A (A:)
gshmhgqvdcspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklag
rwpvktvhtdngsnftsttvkaacwwagikqefgipynpqsqgviesmnkelkkiigqvr
dqaehlktavqmavfihnkkrkggiggysagerivdiiatdiqtke

    Sequence, based on observed residues (ATOM records): (download) 
    >7d83A (A:)
cspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvht
dngsnftsttvkaacwwagikqefiesmnkelkkiigqvrdqaehlktavqmavfihnkk
rkgysagerivdiiatdiq